close all open/close all

CDS information : Mith_00270


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction30,885 / 31,865 / + [in whole cluster]
30,885 / 31,865 / + [in contig]
Location30885..31865 [in whole cluster]
30885..31865 [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-methyltransferase
Product (GenBank)C-methyltransferase
Gene
Gene (GenBank)mtmMII
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10652287] Characterization of two polyketide methyltransferases involved in the biosynthesis of the antitumor drug mithramycin by Streptomyces argillaceus. (J Biol Chem. , 2000)
[14660589] MtmMII-mediated C-methylation during biosynthesis of the antitumor drug mithramycin is essential for biological activity and DNA-drug interaction. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>C-methyltransferase [C-methyltransferase]
MAQAVRRAGVLCAGMDLAVFDTMADGPADAETIAARLDVPVRGARVLLRALAAIDLLKTD
GERFWLAPGVDRVLVRSSPGWFGDILRHAVSRYEWDALGRLSDAVRRGGTVLDTNAETPD
YPFWADLARTPTPHTPLVADLLADTLEPWAAGRERLDVLDVACGHGLYGYTVARRYPQAR
VRSVDWPGVLEHSRGHAERLGVLDRVELTPGDMFDVPLGGPYDLSLITNVLHHFSAERAG
EMLRRLAEATRPGGRIGIVAVTADGRDPASDPVPHLFAALMLAWTHEGESHALETYRDLL
TANGFGEPRLHEVGGVPLRLLLAERL
selected fasta
>C-methyltransferase [C-methyltransferase]
ATGGCCCAGGCGGTGCGCCGCGCCGGAGTGTTGTGTGCCGGGATGGACCTCGCCGTCTTC
GACACGATGGCGGACGGACCGGCCGACGCCGAGACCATCGCCGCCCGGCTGGACGTGCCG
GTCCGGGGCGCGCGGGTCCTGCTGCGGGCGCTCGCCGCGATCGACCTTCTGAAGACGGAC
GGCGAGCGTTTCTGGCTGGCCCCCGGAGTCGACCGGGTCCTGGTCCGGTCCAGCCCCGGC
TGGTTCGGCGACATCCTCCGGCACGCGGTCAGCCGTTACGAGTGGGATGCCCTGGGCCGC
CTCTCGGACGCGGTCCGGCGCGGCGGAACGGTGCTGGACACCAACGCCGAGACCCCCGAC
TACCCGTTCTGGGCGGACCTGGCCCGCACCCCCACCCCGCACACCCCCCTGGTCGCCGAT
CTACTGGCCGACACCCTGGAGCCGTGGGCGGCGGGCCGCGAGCGCCTGGACGTCCTGGAC
GTGGCCTGCGGGCACGGGCTGTACGGCTACACGGTGGCTCGGCGCTATCCGCAGGCGCGG
GTCCGTTCCGTCGACTGGCCGGGCGTCCTGGAGCACTCCCGGGGCCACGCGGAGCGCCTG
GGCGTGCTGGACCGGGTCGAACTGACCCCGGGCGACATGTTCGACGTGCCGCTGGGCGGC
CCGTACGACCTGTCGCTGATCACCAATGTGCTGCACCACTTCTCCGCCGAGCGTGCGGGC
GAGATGCTGCGGCGCCTGGCGGAGGCGACCCGGCCGGGCGGGCGGATCGGCATCGTCGCG
GTCACCGCGGACGGCCGTGACCCGGCGTCCGACCCGGTCCCCCACCTGTTCGCCGCGTTG
ATGTTGGCCTGGACCCACGAAGGCGAGTCGCACGCGCTGGAGACCTACCGGGACCTGCTG
ACGGCCAACGGTTTCGGGGAGCCCCGGCTGCACGAGGTGGGCGGGGTGCCGCTGCGCCTG
CTGCTCGCAGAGCGGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [158-300]  5.10000000000001e-16 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [2-68]  8.30000000000004e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit