close all open/close all

CDS information : Mith_00280


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction31,928 / 32,965 / + [in whole cluster]
31,928 / 32,965 / + [in contig]
Location31928..32965 [in whole cluster]
31928..32965 [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductO-methyltransferase
Product (GenBank)O-methyltransferase
Gene
Gene (GenBank)mtmMI
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10652287] Characterization of two polyketide methyltransferases involved in the biosynthesis of the antitumor drug mithramycin by Streptomyces argillaceus. (J Biol Chem. , 2000)

close this sectionSequence

selected fasta
>O-methyltransferase [O-methyltransferase]
MTNTPAAAPSPADAREILQLNVAYTRARVLHTAMELGLFEYLSAGPRTEAEIREHGRLHS
HLVRDWLDALVGLGLLTADGGTYANTPRAEHFLVPGHPHYIGGAVLQHGRVHYELWNRFA
DALRDGKATSGKDITAGAVVEEQPDLDRARRFLDHMDTFNQFVVAELSKALDWSRWKTFV
DVGGARGNVAAQLVLDHPDLKGSVFDVPGVEPLFDEHMAARGTTGRVDFVGGDFFTDALP
AADVVLFGHVLHDHPEESRKRLLGQAFRALPPGGTLLVYDAMLDDRSEAGAYLQSLVCSV
ILDGGSEYRVRDITAWAEETGFTVEQVVPLDTMTHDRLFVARKPG
selected fasta
>O-methyltransferase [O-methyltransferase]
ATGACGAACACCCCTGCGGCCGCCCCTTCGCCGGCCGACGCCCGTGAGATCCTCCAGCTC
AATGTCGCCTACACCCGGGCCCGGGTTCTGCACACCGCCATGGAGCTGGGCCTCTTCGAG
TACCTCTCCGCGGGTCCGCGCACCGAGGCGGAGATCCGCGAGCACGGCCGGCTGCACTCC
CACCTCGTGCGCGACTGGCTGGACGCACTGGTCGGGCTGGGCCTGCTGACCGCCGACGGC
GGAACGTACGCCAACACACCCCGCGCGGAGCACTTCCTGGTCCCGGGCCACCCGCACTAC
ATCGGCGGCGCAGTGCTGCAGCACGGCCGGGTCCACTACGAGCTGTGGAACCGCTTCGCC
GACGCCCTGCGCGACGGCAAGGCCACCTCGGGCAAGGACATCACCGCGGGCGCGGTGGTG
GAGGAACAGCCGGATCTGGACCGGGCCCGCCGGTTCCTCGACCACATGGACACCTTCAAC
CAGTTCGTGGTCGCGGAGCTGAGCAAGGCCCTGGACTGGAGCCGCTGGAAGACGTTCGTG
GATGTCGGCGGAGCCCGCGGCAACGTTGCGGCACAACTGGTGCTGGACCACCCGGACCTG
AAGGGCTCGGTCTTCGACGTGCCCGGCGTGGAGCCGCTGTTCGACGAGCACATGGCGGCC
CGCGGCACCACGGGCCGAGTCGACTTCGTGGGCGGGGACTTCTTCACCGACGCCCTGCCC
GCCGCCGACGTGGTGCTCTTCGGTCACGTCCTGCACGACCACCCGGAGGAAAGCCGCAAG
CGGCTGCTGGGCCAGGCGTTCCGCGCCCTGCCCCCGGGCGGCACACTGCTGGTCTACGAC
GCGATGCTCGACGACCGCTCCGAGGCGGGGGCCTATCTGCAGAGCCTGGTGTGCTCCGTC
ATCCTCGACGGAGGCTCGGAGTACCGGGTGCGCGACATCACGGCCTGGGCCGAGGAGACC
GGCTTCACGGTGGAGCAGGTCGTCCCGCTGGACACCATGACGCACGACCGGCTCTTCGTG
GCCCGCAAGCCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [81-317]  1.40000000000001e-46 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [11-90]  4.10000000000001e-23 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [4-333]  8.29999581180007e-09 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit