close all open/close all

CDS information : Mith_00290


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction34,253 / 33,114 / - [in whole cluster]
34,253 / 33,114 / - [in contig]
Locationcomplement(33114..34253) [in whole cluster]
complement(33114..34253) [in contig]
TypeCDS
Length1,140 bp (379 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-olivose glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)mtmGII
EC number
Keyword
  • disaccharide 2nd D-olivose
Note
Note (GenBank)
Reference
ACC
PmId
[9733697] Identification of two genes from Streptomyces argillaceus encoding glycosyltransferases involved in transfer of a disaccharide during biosynthesis of the antitumor drug mithramycin. (J Bacteriol. , 1998)
[15712316] Elucidation of the glycosylation sequence of mithramycin biosynthesis: isolation of 3A-deolivosylpremithramycin B and its conversion to premithramycin B by glycosyltransferase MtmGII. (Chembiochem. , 2005)

close this sectionSequence

selected fasta
>D-olivose glycosyltransferase [glycosyltransferase]
MRVLVCSTPLLGHFNPLLPLSWALRAEGHEVLVATDEGFASKVLERGLPVAPLSPVALRD
VMARDRAGRPVPHTAEADRVWRSGHGWGRLGARHLAETVTLARRWRPDLIVTDPVEFAGP
LAAAHLGIPRIEHGWGIRPNHEFALAAEEELEPELHAYGLAGLPRPARVLDTCSPSLQHP
GTVGDPMRYIPVTGPAELPGWLDEPRKLPLVCLTFGSVLPSLAPDRMRGLITRLTHTLPA
LGVEVVVAIDPAGTRGMPPALPGVLSVGWQPVDHLMPRCAVLVHYGSSGMTMAATTAGVP
QVVLTVPIADAPDNARRIEAAGLGIALPALDLDADRVEEACRALLTDPSWRARAAEVAAE
QADRPTAAEVATGLTAAYG
selected fasta
>D-olivose glycosyltransferase [glycosyltransferase]
ATGCGCGTACTGGTCTGTTCCACTCCCCTGCTCGGCCACTTCAATCCCCTGCTGCCGCTG
TCCTGGGCGCTGCGCGCCGAGGGGCACGAGGTCCTGGTGGCCACGGACGAGGGCTTCGCA
TCGAAGGTCCTGGAGCGCGGGCTGCCCGTGGCGCCGCTGTCGCCCGTGGCGCTGCGGGAC
GTGATGGCCCGGGACCGGGCCGGCCGCCCGGTGCCCCACACCGCCGAGGCGGACCGGGTC
TGGCGCAGCGGCCACGGCTGGGGGCGGCTGGGAGCCCGGCACCTGGCGGAGACGGTCACG
CTCGCCCGCCGCTGGCGACCGGACCTGATCGTCACCGACCCCGTGGAGTTCGCGGGTCCG
CTGGCAGCCGCGCACCTCGGCATCCCCCGGATCGAGCACGGCTGGGGCATCCGCCCCAAC
CACGAGTTCGCACTGGCCGCCGAGGAGGAACTCGAACCCGAACTCCACGCGTACGGACTC
GCCGGGCTGCCCCGGCCGGCCCGTGTCCTCGACACCTGTTCGCCCAGCCTCCAGCACCCC
GGCACGGTCGGCGACCCCATGCGCTACATCCCGGTGACCGGCCCCGCCGAACTGCCCGGC
TGGCTGGACGAACCCAGGAAGCTCCCGCTGGTGTGCCTGACCTTCGGCAGTGTGCTGCCG
TCCCTGGCGCCGGACCGCATGCGGGGCCTGATCACCCGGCTGACACACACCCTGCCCGCG
CTCGGCGTGGAGGTGGTGGTGGCCATCGACCCGGCCGGCACACGGGGGATGCCGCCGGCT
CTGCCCGGCGTACTGTCCGTGGGCTGGCAGCCGGTGGACCACCTGATGCCGCGCTGTGCC
GTCCTGGTCCACTACGGGTCCTCCGGCATGACGATGGCCGCGACGACCGCGGGGGTGCCC
CAGGTGGTGCTCACCGTGCCGATCGCCGACGCCCCGGACAACGCGCGGCGCATCGAGGCG
GCGGGGCTGGGCATCGCCCTGCCCGCTCTCGACCTCGACGCCGACCGCGTCGAGGAGGCC
TGCCGGGCGCTGCTCACCGACCCGTCCTGGCGGGCCCGCGCCGCCGAGGTCGCCGCGGAA
CAGGCCGACCGCCCCACGGCCGCCGAAGTCGCGACGGGGCTCACCGCCGCGTACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [280-366]  1.5e-05 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [12-91]  9.10000000000001e-11 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [170-257]  2.5e-12 PF06722
PF06722   DUF1205
SignalP No significant hit
TMHMM No significant hit