close all open/close all

CDS information : Mith_00300


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction34,474 / 35,655 / + [in whole cluster]
34,474 / 35,655 / + [in contig]
Location34474..35655 [in whole cluster]
34474..35655 [in contig]
TypeCDS
Length1,182 bp (393 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-olivose glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)mtmGI
EC number
Keyword
  • disaccharide 1st D-olivose
Note
Note (GenBank)
Reference
ACC
PmId
[9733697] Identification of two genes from Streptomyces argillaceus encoding glycosyltransferases involved in transfer of a disaccharide during biosynthesis of the antitumor drug mithramycin. (J Bacteriol. , 1998)

close this sectionSequence

selected fasta
>D-olivose glycosyltransferase [glycosyltransferase]
MRILFVASVSASHLAPMVPLAWALRSAGHDVRVACDADTAPGALALGLTVVRVSTDGDFA
RRHRESVRGVPGEPYYRERDALPRMFADRSLAMLDGLAALVDRWRPHAVVHEPVAFAAET
VAAARDIPTLRHLWGPDLFGTPPGAWLRHRVRELVTAEVPDSAGASAREVVIDPCPAPLQ
RPGADAVVPVRYVPVDRPGTVPAWLLEPPRGPRVCVTWGTFADGMPGGHPLMRAMRALPR
LGVEVVLVARAEDLARQGGLPAGVRAVTGAPLHAVLPSCTAVVHHGGSNTALGAVVRGLP
QLVVSDTFERDLNAQRLAETGAAVHLEAREAEADPDAVATAVGRLVDDDRYARAAAELRG
LALTRPSPARVAGGFEELLTQWPVAGAPITEGA
selected fasta
>D-olivose glycosyltransferase [glycosyltransferase]
ATGCGCATCTTGTTCGTGGCCTCCGTCTCCGCCTCGCACCTCGCTCCCATGGTTCCGCTG
GCCTGGGCCCTGCGGTCCGCGGGGCACGACGTGCGGGTGGCCTGTGACGCCGACACGGCA
CCGGGTGCGCTGGCGCTCGGGCTGACCGTGGTGCGGGTGAGCACGGACGGCGACTTCGCC
CGGCGGCACCGCGAGAGCGTGCGGGGCGTGCCCGGCGAGCCGTACTACCGGGAGCGGGAC
GCGCTGCCCCGCATGTTCGCCGACCGGTCCCTCGCCATGCTCGACGGTCTGGCGGCACTC
GTCGACCGCTGGCGGCCGCACGCGGTGGTGCACGAGCCGGTGGCCTTCGCCGCGGAAACG
GTCGCCGCCGCACGGGACATCCCCACGCTGCGGCACCTCTGGGGCCCTGACCTCTTCGGT
ACGCCGCCCGGCGCCTGGCTGCGGCACCGGGTGCGCGAGCTGGTGACGGCCGAGGTGCCG
GACAGCGCGGGGGCCTCGGCGCGGGAGGTCGTGATCGACCCCTGTCCCGCTCCGCTGCAG
CGACCGGGGGCCGACGCCGTCGTCCCGGTCCGCTACGTCCCCGTGGACCGGCCGGGAACG
GTCCCGGCCTGGCTGCTGGAACCGCCCCGAGGGCCGCGGGTCTGTGTCACCTGGGGGACG
TTCGCCGACGGCATGCCGGGCGGCCATCCGCTGATGCGGGCGATGCGCGCGCTGCCGCGG
CTCGGCGTGGAGGTGGTGCTCGTCGCGCGCGCCGAGGACCTGGCCCGGCAGGGCGGACTC
CCCGCCGGTGTGCGGGCGGTGACCGGCGCGCCCCTGCACGCCGTCCTGCCCTCGTGCACG
GCGGTCGTGCACCACGGCGGGTCCAACACCGCGCTGGGTGCCGTGGTCCGCGGACTGCCG
CAGCTCGTCGTGAGCGACACCTTCGAACGAGATCTGAACGCGCAGCGGCTGGCGGAGACC
GGTGCGGCGGTGCACCTGGAAGCACGGGAGGCGGAGGCGGATCCGGACGCCGTCGCGACG
GCGGTGGGACGGCTGGTTGACGACGACCGGTACGCGCGGGCCGCCGCGGAACTGCGCGGC
CTGGCCCTGACCCGCCCGTCCCCGGCCCGGGTCGCCGGTGGCTTCGAGGAACTGCTCACC
CAGTGGCCCGTAGCGGGCGCACCGATCACGGAAGGCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-136]  2e-09 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [172-265]  3.3e-20 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.501 Signal
Bacteria, Gram-positive   
 [1-23]  0.453 Signal
Eukaryota   
TMHMM No significant hit