close all open/close all

CDS information : Mith_00320


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction37,327 / 39,813 / + [in whole cluster]
37,327 / 39,813 / + [in contig]
Location37327..39813 [in whole cluster]
37327..39813 [in contig]
TypeCDS
Length2,487 bp (828 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
ProductUvrA-like protein
Product (GenBank)MtrX
Gene
Gene (GenBank)mtrX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8757400] An ABC transporter is essential for resistance to the antitumor agent mithramycin in the producer Streptomyces argillaceus. (Mol Gen Genet. , 1996)
[10779713] Insertional inactivation of mtrX and mtrY genes from the mithramycin gene cluster affects production and growth of the producer organism Streptomyces argillaceus. (FEMS Microbiol Lett. , 2000)
Related Reference
ACC
Q70J73
NITE
Chro_00250
PmId
[17768249] Involvement of a chromomycin ABC transporter system in secretion of a deacetylated precursor during chromomycin biosynthesis. (Microbiology. , 2007)

close this sectionSequence

selected fasta
>UvrA-like protein [MtrX]
MGTGEHAIEVVGARTHNLDDLTVSVPKGRVVAFTGVSGSGKTSLLIDTIHAEAQLRYLEG
ISPFVRQFITPRDRPQVTRIEGLPPTLAVDQRIPARSPRSTLATVTGVGDYLGLAFARLP
PLARDWDPTLGAALKTAQFNPAMPEGCCAQCRGSGGRARSAEALLITEPGRPLLDGASPW
FAMARAPERATVQALCPRRFAADLGQPWREQPEEVRRVVLHGTGEEAVEIAYEATMKKSG
TTVSVRDSRPWPGAIAEAERLYSGAAGPAVRATYEPFVRNEPCAACEGTGLGVVARTVRL
GGRRLHELLDRPVEDVLGWAEGLAATLGPAQREAAQAVLPALRARLRLLVRLGVGHLQLS
RPAPTLSGGELQRARVAAQLCTDLSGVAFVLDEPSPGLHPDKRVWANSSRNCCGSGNTVL
MIEHDPELISRADWVIDVGPGAGRGGGRLVAQGAPREIAAVPESLTGRYLAMPGGRVRRA
RRPVRADRMLSLTDVDVRTVRADRIDIPLGALTCLTGVSGSGKSTLLMDGVAGAVQARLD
GTSAPGVGGVDWTGPLHWATVVDQEPIGRTPRSNPATYTKAFNLIRNLFAGTDAAARRGL
TAGSFSFNSPGGRCEPCTGYGVRQVDMNFLPDVWVTCDVCDGRRFGPEVLAVTYQGLAID
EVLDLTIDEASELLDTPALRPVLTALRRTGLGYMRLGQRRHRAVRAARAQRLKLAALLLT
KGAAGSPDSWCLDEPVTGLHPADVQVLVDARFDVLIAAGNTWSSPSMIFICAAADWLVDM
GPGSRRAGGTVLHCGPPDVLRPDSGPTAGYLCGLLAGRGAPTASVDAV
selected fasta
>UvrA-like protein [MtrX]
ATGGGGACCGGGGAGCACGCCATCGAGGTGGTCGGCGCCCGAACGCACAACCTGGACGAT
CTGACGGTCTCCGTGCCCAAGGGCCGGGTCGTCGCGTTCACGGGAGTGAGCGGCAGCGGC
AAGACCTCACTGCTGATCGACACCATCCACGCCGAGGCCCAGCTGCGGTATCTGGAGGGG
ATCAGCCCGTTCGTACGGCAGTTCATCACTCCGCGGGATCGCCCGCAGGTGACCCGGATC
GAGGGGCTGCCCCCCACGCTCGCCGTCGACCAGCGGATCCCGGCGCGCAGCCCGCGCTCC
ACGCTGGCCACCGTCACCGGAGTCGGCGACTACCTTGGTCTCGCCTTCGCCCGGCTGCCT
CCGCTGGCCAGGGACTGGGACCCGACGCTGGGCGCGGCGCTGAAGACGGCGCAGTTCAAC
CCGGCCATGCCGGAGGGGTGCTGCGCGCAGTGCCGCGGCAGCGGAGGCCGGGCCCGGTCA
GCAGAGGCCCTGCTGATCACCGAGCCCGGTCGGCCGCTGCTGGACGGGGCGTCGCCGTGG
TTCGCCATGGCGCGCGCCCCCGAGCGGGCGACGGTCCAGGCGCTGTGCCCGCGGCGCTTC
GCGGCGGATCTCGGCCAGCCCTGGCGCGAGCAGCCCGAGGAGGTCCGGCGGGTGGTGCTG
CACGGAACCGGCGAGGAAGCGGTGGAGATCGCCTACGAGGCGACCATGAAGAAGAGCGGC
ACGACGGTCAGTGTCCGTGACAGCCGCCCGTGGCCGGGGGCGATCGCCGAGGCGGAGCGG
CTGTACAGTGGCGCGGCCGGTCCCGCCGTCCGGGCGACGTACGAGCCGTTCGTCCGCAAC
GAGCCCTGTGCCGCGTGCGAGGGGACGGGCCTGGGCGTGGTCGCCCGTACCGTGCGGCTC
GGCGGCCGGCGCCTGCACGAACTCCTCGACCGTCCGGTCGAGGACGTGCTCGGCTGGGCC
GAAGGCCTGGCCGCGACGCTCGGGCCGGCCCAACGGGAGGCGGCGCAGGCGGTTCTGCCC
GCCCTCCGGGCGCGGCTCAGGCTGCTGGTCCGGCTCGGGGTCGGACACCTCCAGCTCTCC
CGCCCGGCTCCCACGCTGTCCGGCGGGGAACTGCAGCGGGCCCGGGTGGCGGCCCAGCTG
TGCACCGATCTGTCGGGGGTGGCGTTCGTCCTGGACGAGCCGTCGCCGGGGCTGCACCCG
GACAAGCGCGTCTGGGCGAACTCATCGAGGAACTGCTGCGGCTCCGGGAACACCGTCCTC
ATGATCGAACACGATCCCGAGCTGATCTCCCGGGCGGACTGGGTGATCGACGTCGGTCCG
GGGGCCGGGCGCGGGGGCGGAAGGCTGGTGGCCCAAGGCGCTCCGCGGGAGATCGCGGCC
GTCCCCGAATCGCTGACCGGCCGCTATCTGGCGATGCCGGGCGGACGGGTGCGGCGCGCG
CGGCGCCCGGTGCGCGCCGACCGGATGCTCAGCCTGACCGATGTCGACGTGCGGACCGTG
CGAGCCGACCGGATCGACATCCCGCTGGGCGCGCTGACCTGCCTCACGGGCGTGAGCGGC
AGCGGCAAGAGCACGCTGCTCATGGACGGCGTGGCCGGGGCGGTACAGGCTCGGCTCGAC
GGGACGAGCGCGCCGGGTGTCGGCGGGGTGGACTGGACGGGCCCGCTGCACTGGGCGACC
GTGGTCGACCAGGAGCCCATCGGCAGGACACCGCGCTCCAATCCGGCGACGTACACCAAG
GCGTTCAACCTGATCCGCAATCTGTTCGCGGGCACTGACGCCGCCGCCCGCCGCGGACTG
ACGGCGGGCTCGTTCTCCTTCAACTCGCCGGGCGGACGCTGCGAACCGTGCACCGGGTAC
GGCGTACGGCAGGTCGACATGAACTTCCTGCCCGACGTCTGGGTCACCTGTGACGTGTGC
GACGGCAGGCGGTTCGGGCCCGAGGTGCTGGCGGTGACCTACCAGGGGCTGGCCATCGAC
GAGGTGCTGGACCTGACCATCGACGAGGCGAGCGAGTTGCTGGACACGCCTGCGCTGCGG
CCGGTGCTCACGGCGCTGCGGCGGACGGGGCTGGGCTACATGCGGCTGGGGCAGAGGCGC
CACCGTGCTGTCCGGGCGGCGAGGGCGCAGCGGCTGAAGCTCGCCGCGCTGCTGCTCACC
AAGGGCGCGGCCGGCAGCCCGGACTCGTGGTGCCTGGACGAGCCGGTCACCGGTCTGCAT
CCGGCGGACGTGCAAGTGCTGGTCGACGCCCGGTTCGACGTGCTGATCGCCGCGGGCAAC
ACGTGGTCCTCGCCGAGCATGATCTTCATCTGCGCCGCCGCGGACTGGCTGGTCGACATG
GGCCCGGGCAGCCGGCGCGCTGGCGGCACGGTGTTGCACTGCGGCCCTCCGGACGTCCTC
CGCCCGGACTCGGGCCCCACCGCCGGGTATCTGTGCGGGCTGCTCGCCGGCCGAGGTGCT
CCCACAGCATCAGTCGATGCCGTATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR017871 ABC transporter, conserved site (Conserved_site)
 [366-380]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit