close all open/close all

CDS information : Mith_00330


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction39,841 / 40,500 / + [in whole cluster]
39,841 / 40,500 / + [in contig]
Location39841..40500 [in whole cluster]
39841..40500 [in contig]
TypeCDS
Length660 bp (219 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative PadR family transcriptional regulator
Product (GenBank)MtrY protein
Gene
Gene (GenBank)mtrY
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8757400] An ABC transporter is essential for resistance to the antitumor agent mithramycin in the producer Streptomyces argillaceus. (Mol Gen Genet. , 1996)
[10779713] Insertional inactivation of mtrX and mtrY genes from the mithramycin gene cluster affects production and growth of the producer organism Streptomyces argillaceus. (FEMS Microbiol Lett. , 2000)
Family/Domain
FD
IPR005149

close this sectionSequence

selected fasta
>putative PadR family transcriptional regulator [MtrY protein]
MAVRKRPVSNLLGLAVLGLLLEHAMHPYEMAATLRERNKDTSFKVRTGSLYDVVEAWYGR
WIAEHSTERAGRRPERTVYAHTDLGREEFMSWLDELVRTPVKEYPSFLAAVSYLGALGPE
RAVQALRERIARLDEQIEEARRARTAVLDQQTPRLFVIELEYALTMAEAERDWARRIVAE
VHGGTLAWPELTTKEGREVWTDQDETEDKTDDRTEKQQV
selected fasta
>putative PadR family transcriptional regulator [MtrY protein]
ATGGCGGTGCGCAAACGGCCGGTGTCCAACCTGCTCGGGCTCGCGGTCCTCGGCCTGCTG
CTGGAGCACGCGATGCATCCGTACGAGATGGCCGCGACCCTGCGGGAGCGCAACAAGGAC
ACGAGCTTCAAGGTCAGGACCGGCTCGCTCTACGACGTCGTGGAGGCCTGGTACGGGCGC
TGGATCGCCGAGCACAGCACTGAACGTGCCGGACGCCGACCGGAGCGCACCGTGTACGCC
CATACCGACCTGGGCCGCGAGGAGTTCATGAGCTGGCTCGACGAACTGGTCCGCACCCCG
GTGAAGGAGTACCCCAGCTTCCTCGCCGCGGTGAGCTACCTCGGCGCCCTCGGGCCGGAA
CGCGCCGTCCAGGCCCTGCGGGAACGCATCGCCCGCCTGGACGAGCAGATCGAGGAGGCC
CGCCGGGCACGGACCGCGGTGCTGGACCAGCAGACGCCACGGCTGTTCGTGATCGAACTC
GAATACGCCCTGACCATGGCCGAAGCCGAGCGGGACTGGGCCCGGCGGATCGTCGCCGAA
GTCCACGGCGGCACCCTCGCCTGGCCCGAACTCACCACCAAGGAAGGCCGCGAGGTATGG
ACCGACCAGGACGAGACGGAAGACAAGACGGACGACAGGACGGAGAAGCAGCAGGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005149 Transcription regulator PadR N-terminal (Domain)
 [16-89]  1.2e-06 PF03551
PF03551   PadR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [12-96]  3.2e-12 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-31]  0.55 Signal
Eukaryota   
TMHMM No significant hit