close all open/close all

CDS information : Mith_00340


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction40,562 / 41,524 / + [in whole cluster]
40,562 / 41,524 / + [in contig]
Location40562..41524 [in whole cluster]
40562..41524 [in contig]
TypeCDS
Length963 bp (320 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productmithramycin resistance ABC transporter ATP-binding protein
Product (GenBank)
Gene
Gene (GenBank)mtrA
EC number
Keyword
Note
Note (GenBank)
  • ATP-binding protein involved in mithramycin resistance
Reference
ACC
PmId
[8757400] An ABC transporter is essential for resistance to the antitumor agent mithramycin in the producer Streptomyces argillaceus. (Mol Gen Genet. , 1996)
Related Reference
ACC
Q70J75
NITE
Chro_00230
PmId
[17768249] Involvement of a chromomycin ABC transporter system in secretion of a deacetylated precursor during chromomycin biosynthesis. (Microbiology. , 2007)

close this sectionSequence

selected fasta
>mithramycin resistance ABC transporter ATP-binding protein
MIQAKGLAKTFTTKQGPVEAVAGVDFTVHTGEIVGFLGPNGAGKTTTMRMLTTLLPPSSG
TAVIAGRDLLHEPAKVRTHIGYVSQAGGAKPSSPVRRDLVLQGRLYGMSRSEAEARADEV
ITQLGLEELADRIIQTLSGCQARRVDMALGLMHQPELLFLDEPTANLDPESRNDVWEHIR
RLRDERGTTVFLTTHYLDEADSLCDRVLIIDKGRIIAEDSPRSLKAAISHDTIEIEVADD
TARATELLAAHRDVHEVSVNGTVLSISCRDAERLLADLLRTLESARIRVESLRVLKPTLD
DVFMTLTDRRSQRGADAVHA
selected fasta
>mithramycin resistance ABC transporter ATP-binding protein
ATGATCCAGGCCAAGGGGCTGGCCAAGACGTTCACCACCAAGCAGGGCCCGGTCGAGGCG
GTGGCCGGAGTCGACTTCACCGTCCACACGGGCGAGATCGTGGGCTTCCTGGGGCCCAAC
GGCGCCGGCAAGACCACCACCATGCGGATGCTGACCACGCTGCTCCCGCCGAGTTCGGGC
ACGGCCGTCATCGCCGGCCGCGATCTGCTGCACGAGCCCGCGAAGGTCCGCACGCACATC
GGCTACGTCTCCCAGGCGGGCGGCGCCAAGCCGAGCTCCCCGGTCCGCCGGGACCTCGTC
CTCCAAGGCCGCCTCTACGGCATGTCCCGCTCCGAGGCCGAGGCCCGCGCCGACGAGGTG
ATCACCCAGCTCGGCCTCGAAGAACTCGCGGACCGGATCATCCAGACCCTCTCCGGCTGT
CAGGCCCGCCGCGTCGACATGGCGCTGGGCCTGATGCACCAGCCGGAGCTGCTCTTCCTC
GACGAACCCACCGCCAACCTCGACCCCGAGAGCCGCAACGACGTCTGGGAGCACATCCGT
CGCCTGCGTGACGAGCGCGGCACCACCGTGTTCCTCACCACCCACTACCTCGACGAGGCC
GACAGCCTCTGCGACCGCGTCCTGATCATCGACAAGGGCCGCATCATCGCCGAGGACAGT
CCGCGGAGCCTGAAGGCCGCCATCTCCCACGACACCATCGAGATCGAGGTGGCCGACGAC
ACCGCACGGGCCACCGAACTGCTCGCCGCCCACCGCGACGTCCACGAGGTGTCGGTGAAC
GGCACGGTTCTGTCGATCAGTTGCCGCGACGCCGAGCGCCTCCTCGCCGACCTGCTGCGC
ACGCTGGAGTCCGCGCGCATCCGGGTGGAGTCCCTGCGGGTGCTGAAGCCCACGCTCGAC
GACGTCTTCATGACCCTGACCGACCGACGTTCGCAGCGCGGCGCGGACGCCGTCCACGCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [45-165]  5.00000000000001e-17 PF00005
PF00005   ABC_tran
 [2-237]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [30-222]  3.30000526807186e-17 SM00382
SM00382   AAA
IPR005894 Daunorubicin resistance ABC transporter ATP-binding subunit (Family)
 [16-307]  4.49999999999996e-96 TIGR01188
TIGR01188   DrrA
SignalP No significant hit
TMHMM No significant hit