close all open/close all
Mith_00340 Mith_00340   last last

CDS information : Mith_00350


close this sectionLocation

Organism
StrainATCC 12956
Entry nameMithramycin
Contig
Start / Stop / Direction41,587 / 42,288 / + [in whole cluster]
41,587 / 42,288 / + [in contig]
Location41587..42288 [in whole cluster]
41587..42288 [in contig]
TypeCDS
Length702 bp (233 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productmithramycin resistance ABC transporter permease protein
Product (GenBank)
Gene
Gene (GenBank)mtrB
EC number
Keyword
Note
Note (GenBank)
  • membrane protein involved in mithramycin resistance
Reference
ACC
PmId
[8757400] An ABC transporter is essential for resistance to the antitumor agent mithramycin in the producer Streptomyces argillaceus. (Mol Gen Genet. , 1996)
Related Reference
ACC
Q70J76
NITE
Chro_00220
PmId
[17768249] Involvement of a chromomycin ABC transporter system in secretion of a deacetylated precursor during chromomycin biosynthesis. (Microbiology. , 2007)

close this sectionSequence

selected fasta
>mithramycin resistance ABC transporter permease protein
MAQKRMGLLIGLVQPFVYMALFGPLLVKMLPEDGPAAWQVYIPGLLVQLGLFATALRRFG
LIPDVRSGYLERLRVTPASRLGLLLGRVLWDVLALFIQSVVIVLIALLFGLRAPFGGVVA
AIALMMLVGISLAFLSYALAMKLTSEWLFAPVLNAIALPLMLLSGILLPLTYAPGWLQAI
GDANPLRYAVDAMRDFFTGDYTSHHVVVGVAVVLGLMVVSAVGGTRIFAKYNA
selected fasta
>mithramycin resistance ABC transporter permease protein
GTGGCCCAAAAGAGGATGGGTCTCCTCATCGGCCTCGTCCAGCCGTTCGTCTACATGGCC
CTGTTCGGCCCCCTCCTGGTCAAGATGCTGCCGGAGGACGGCCCGGCCGCCTGGCAGGTC
TACATCCCGGGCCTGCTGGTGCAACTGGGTCTGTTCGCCACCGCGCTACGCCGGTTCGGT
CTCATCCCCGACGTCCGTTCCGGCTACCTGGAACGGCTGCGGGTGACCCCGGCGAGCCGG
CTCGGTCTGCTCCTCGGCAGGGTCCTCTGGGACGTCCTGGCCCTGTTCATCCAGTCGGTG
GTCATCGTCCTCATCGCCCTGCTCTTCGGCCTGCGCGCGCCGTTCGGCGGCGTCGTGGCC
GCCATCGCCCTGATGATGCTCGTCGGCATCAGTCTGGCCTTCCTCTCCTACGCGCTGGCC
ATGAAGCTGACATCGGAGTGGCTCTTCGCCCCCGTCCTCAACGCCATCGCCCTGCCTCTG
ATGCTGCTGTCCGGCATCCTCCTGCCCCTGACCTACGCCCCCGGCTGGCTCCAGGCCATC
GGCGACGCCAACCCCCTGCGCTACGCGGTGGACGCCATGCGCGACTTCTTCACCGGCGAC
TACACCTCCCACCACGTCGTGGTCGGCGTGGCCGTGGTGCTCGGCCTGATGGTCGTCTCG
GCGGTGGGTGGCACCCGCATCTTCGCCAAGTACAACGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000412 ABC-2 (Family)
 [6-231]  PS51012
PS51012   ABC_TM2
IPR013525 ABC-2 type transporter (Domain)
 [4-196]  1.69999999999999e-24 PF01061
PF01061   ABC2_membrane
SignalP No significant hit
TMHMM
 [7-27]  Transmembrane (i-o) [37-56]  Transmembrane (o-i) [92-114]  Transmembrane (i-o) [118-140]  Transmembrane (o-i) [147-169]  Transmembrane (i-o) [206-228]  Transmembrane (o-i)
Transmembrane 6   
Mith_00340 Mith_00340   last last