close all open/close all
first first   Monen_00020 Monen_00020

CDS information : Monen_00010


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction1,038 / 1 / - [in whole cluster]
1,038 / 1 / - [in contig]
Locationcomplement(1..1038) [in whole cluster]
complement(1..1038) [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative NADP-specific glutamate dehydrogenase(fragment)
Product (GenBank)glutamate dehydrogenase
Gene
Gene (GenBank)gdhA
EC number1.4.1.4
Keyword
Note
Note (GenBank)
  • similar to glutamate dehydrogenase
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
P31026
PmId
[1552846] Molecular analysis of the Corynebacterium glutamicum gdh gene encoding glutamate dehydrogenase. (Mol Microbiol. , 1992)

close this sectionSequence

selected fasta
>putative NADP-specific glutamate dehydrogenase(fragment) [glutamate dehydrogenase]
MTTRPDTKTALSQKTALSQLLTEIEHRNPAQPEFHQAAREVLETLAPVIAARPEYAEAGL
IERLCEPERQIVFRVPWQDDHGRVRVNRGFRVEFNSALGPYKGGLRFHPSVNLGVIKFLG
FEQIFKNALTGLGIGGGKGGSDFDPRGRSDAEVMRFCQSFMTELYRHIGEHTDVPAGDIG
VGGREIGYLFGQYRRITNRWEAGVLTGKGRNWGGSLIRPEATGYGNVLFAAAMLRERGET
LEGRTAVVSGSGNVAIYTIQKLAALGANAVTCSDSSGYVVDEKGIDLDLLKQVKEVERAR
VDTYAQRRGASARFVPGRRVWEVPADIALPSATQNELDADDATALI
selected fasta
>putative NADP-specific glutamate dehydrogenase(fragment) [glutamate dehydrogenase]
TTGACCACGCGACCCGACACGAAGACAGCTCTCTCGCAGAAGACAGCACTCTCCCAGCTG
CTCACCGAGATCGAACACCGCAACCCGGCCCAGCCGGAGTTCCACCAGGCCGCCCGCGAG
GTCCTCGAGACCCTGGCGCCGGTCATCGCGGCTCGCCCCGAGTACGCCGAAGCCGGCCTG
ATCGAGCGCCTGTGCGAACCGGAGCGCCAGATCGTCTTCCGGGTGCCGTGGCAGGACGAC
CACGGTCGCGTGCGGGTCAACCGCGGCTTCCGGGTGGAGTTCAACAGCGCCCTCGGCCCG
TACAAGGGCGGCCTGCGCTTCCACCCGTCGGTGAACCTCGGCGTCATCAAGTTCCTGGGC
TTCGAGCAGATCTTCAAGAACGCGCTGACGGGCCTCGGCATCGGCGGCGGCAAGGGCGGC
AGCGACTTCGACCCGCGCGGCCGCAGCGACGCGGAAGTCATGCGTTTCTGCCAGTCGTTC
ATGACGGAGCTGTACCGGCACATCGGCGAACACACGGACGTGCCCGCGGGCGACATCGGC
GTCGGCGGCCGGGAGATCGGCTATCTGTTCGGTCAGTACCGGCGCATCACCAACCGCTGG
GAGGCGGGCGTCCTCACCGGCAAGGGCCGCAACTGGGGCGGCTCCCTGATCCGTCCGGAG
GCGACCGGCTACGGCAACGTCCTCTTCGCGGCGGCGATGCTGCGTGAGCGCGGCGAGACC
CTCGAAGGCCGGACGGCGGTCGTGTCCGGCTCCGGGAACGTCGCCATCTACACCATCCAG
AAGCTCGCCGCCCTGGGCGCCAACGCCGTGACGTGTTCGGACTCCTCCGGTTACGTCGTC
GACGAGAAGGGCATCGACCTGGACCTCCTCAAGCAGGTCAAGGAGGTCGAACGCGCCCGC
GTGGACACCTACGCCCAGCGCCGCGGCGCCTCGGCCCGCTTCGTGCCGGGCCGCCGGGTC
TGGGAGGTGCCTGCCGACATCGCGCTGCCGTCCGCCACGCAGAACGAGCTGGACGCCGAC
GACGCCACCGCGCTGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006095 Glutamate/phenylalanine/leucine/valine dehydrogenase (Family)
 [132-145]  PS00074
PS00074   GLFV_DEHYDROGENASE
 [124-138]  7.00000734129907e-22 PR00082 [204-226]  7.00000734129907e-22 PR00082 [246-266]  7.00000734129907e-22 PR00082
PR00082   GLFDHDRGNASE
IPR006096 Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal (Domain)
 [213-346]  2.59999999999998e-41 PF00208
PF00208   ELFV_dehydrog
 [215-345]  5.7999965385478e-09 SM00839
SM00839   ELFV_dehydrog
IPR006097 Glutamate/phenylalanine/leucine/valine dehydrogenase, dimerisation domain (Domain)
 [67-197]  1.70000000000001e-47 PF02812
PF02812   ELFV_dehydrog_N
IPR016040 NAD(P)-binding domain (Domain)
 [220-345]  1.2e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit
first first   Monen_00020 Monen_00020