close all open/close all

CDS information : Monen_00020


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction2,140 / 1,220 / - [in whole cluster]
2,140 / 1,220 / - [in contig]
Locationcomplement(1220..2140) [in whole cluster]
complement(1220..2140) [in contig]
TypeCDS
Length921 bp (306 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative dihydrodipicolinate synthase
Product (GenBank)dihidro-dipicolinate synthase
Gene
Gene (GenBank)dapA
EC number4.2.1.52
Keyword
Note
Note (GenBank)
  • similar to dihidro-dipicolinate synthase
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
P0A6L2
PmId
[1463470] Escherichia coli dihydrodipicolinate synthase. Identification of the active site and crystallization. (Biochem J. , 1992)
[15158272] Expression from the Escherichia coli dapA promoter is regulated by intracellular levels of diaminopimelic acid. (FEMS Microbiol Lett. , 2004)

close this sectionSequence

selected fasta
>putative dihydrodipicolinate synthase [dihidro-dipicolinate synthase]
MTLASSLEPTTEPLFNGLYVPLVTPFTDDLRLAPEALARLADEALSAGASGLVALGTTAE
AATLTAEERETVIRVCSAACRAHGAPLIVGVGTNDTATAITALRELAARGDVAAALVPAP
PYIRPGEAGTLAHFAALAEHGGLPLVVYDIPYRTGQTLGAGTITALGRLPEVVGIKHATG
SIDPTTMELLDSPLPGFAVLGGDDIVLSPLVAAGAHGGIVASANLRTADYAEMIALWRRG
SAAPARALGADLARLSAALFTEPNPTVIKGVLHAQNRIPSPAVRMPLLAASADSVRRAAP
LAASRK
selected fasta
>putative dihydrodipicolinate synthase [dihidro-dipicolinate synthase]
ATGACCCTCGCATCGAGCCTCGAACCGACCACCGAACCGCTCTTCAACGGCCTGTACGTC
CCCCTGGTAACTCCGTTCACCGACGATCTGCGCCTGGCCCCCGAGGCGCTGGCCCGACTC
GCCGACGAGGCGCTGTCGGCCGGCGCCTCCGGGCTCGTCGCCCTCGGTACGACCGCCGAG
GCCGCCACACTGACCGCCGAGGAGAGAGAGACGGTGATCCGCGTCTGCTCGGCCGCGTGC
CGGGCACACGGGGCACCGCTCATCGTCGGGGTGGGCACCAACGACACCGCCACCGCCATC
ACGGCCCTGCGAGAGCTGGCGGCCCGGGGTGACGTCGCCGCCGCGCTGGTCCCCGCGCCG
CCCTACATCCGCCCCGGGGAAGCGGGGACCCTGGCTCATTTCGCCGCGCTGGCCGAGCAC
GGCGGCCTCCCCCTGGTCGTGTACGACATCCCTTACCGCACCGGGCAGACGCTCGGCGCG
GGCACGATCACCGCACTCGGCCGCCTGCCGGAGGTCGTCGGCATCAAGCACGCGACCGGC
TCGATCGACCCGACCACCATGGAGTTGCTCGACTCGCCCCTGCCCGGCTTCGCCGTGCTC
GGCGGTGACGACATCGTCCTCTCGCCGCTGGTCGCTGCGGGCGCCCACGGCGGAATCGTG
GCGTCGGCCAATCTGCGTACCGCCGACTACGCCGAGATGATCGCGCTGTGGCGACGCGGC
TCCGCCGCACCCGCCCGCGCTCTCGGAGCCGACCTCGCCCGCCTTTCCGCCGCCCTCTTC
ACCGAACCGAACCCGACGGTGATCAAGGGAGTGCTGCACGCCCAGAACCGCATTCCCAGC
CCGGCCGTCCGCATGCCACTGCTGGCCGCCTCCGCCGATTCGGTCCGCCGGGCGGCACCC
CTGGCCGCGAGCCGGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002220 Dihydrodipicolinate synthetase-like (Family)
 [12-304]  5.10003242202156e-90 PIRSF001365
PIRSF001365   DHDPS
 [48-69]  4.60000044330862e-20 PR00146 [85-103]  4.60000044330862e-20 PR00146 [118-134]  4.60000044330862e-20 PR00146 [143-160]  4.60000044330862e-20 PR00146
PR00146   DHPICSNTHASE
 [15-293]  1.80000000000002e-55 PF00701
PF00701   DHDPS
IPR013785 Aldolase-type TIM barrel (Domain)
 [14-298]  7.5e-74 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
IPR020625 Dihydrodipicolinate synthetase, active site (Active_site)
 [148-178]  PS00666
PS00666   DHDPS_2
SignalP No significant hit
TMHMM No significant hit