close all open/close all

CDS information : Monen_00030


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction2,211 / 3,152 / + [in whole cluster]
2,211 / 3,152 / + [in contig]
Location2211..3152 [in whole cluster]
2211..3152 [in contig]
TypeCDS
Length942 bp (313 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LysR family transcriptional regulator
Product (GenBank)hypothetical DNA binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • SCN_3
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Family/Domain
FD
IPR000847, IPR005119

close this sectionSequence

selected fasta
>putative LysR family transcriptional regulator [hypothetical DNA binding protein]
MLDVRRLHLLRELDRRGTIAAVAEALTFTASAVSQQLGVLEREAGVPLLERSGRRVVLTP
AGRSLVAHADAVLNRLEQAVAELAGARDGIGGPLRIGTFPSGGHTIVPGALAELASRHPA
LEPMVREIDSARVSDGLRAGELDVALVHDYDFVPATPDTTVDEVPLLEEPMYLVTHAADT
ATDSGSGSTLAALLGPCAEVPWITARDGTTGHAMAVRACQAAGFQPRIRHQVNDFRTVLA
LVAAGQGAGFVPRMAAEPSPAGVVLTKLPLFRRSKVAFRAGGGAHPAIAAFVAAATTAVE
RMAGSRGPAGGSE
selected fasta
>putative LysR family transcriptional regulator [hypothetical DNA binding protein]
ATGCTCGATGTCCGTCGCCTCCATCTGCTCCGCGAACTCGACCGGCGGGGCACCATCGCC
GCCGTGGCCGAAGCGCTGACCTTCACCGCGTCCGCCGTCTCCCAGCAGCTCGGCGTGCTG
GAGAGGGAGGCGGGCGTGCCGCTGTTGGAACGCAGCGGCAGGCGCGTGGTCCTCACGCCC
GCAGGACGCTCCCTCGTCGCACACGCCGACGCGGTGCTGAACCGTCTCGAACAGGCGGTC
GCCGAGCTGGCGGGCGCACGGGACGGCATCGGCGGGCCGCTGCGCATCGGGACGTTCCCT
TCCGGCGGCCACACCATCGTCCCCGGCGCGCTGGCCGAACTGGCCTCTCGTCACCCCGCG
TTGGAGCCGATGGTGCGGGAGATCGACTCCGCGCGCGTCTCCGACGGTCTGCGGGCCGGT
GAGCTGGACGTGGCCCTCGTACACGACTACGACTTCGTACCCGCGACGCCGGACACGACC
GTGGACGAGGTGCCTCTGCTCGAAGAGCCGATGTACCTCGTCACCCATGCCGCGGACACT
GCCACGGACTCCGGCTCCGGGAGCACACTGGCAGCGCTGCTCGGGCCCTGTGCCGAGGTT
CCGTGGATCACGGCGCGGGACGGCACGACCGGTCACGCGATGGCTGTACGCGCCTGTCAG
GCCGCCGGGTTCCAGCCCAGGATCCGCCACCAGGTCAACGACTTCCGCACGGTGCTGGCT
CTGGTCGCCGCCGGGCAGGGGGCCGGGTTCGTGCCGCGGATGGCCGCCGAGCCGAGCCCC
GCGGGCGTGGTGCTCACGAAGCTGCCGCTGTTCCGTCGCTCGAAGGTCGCGTTCCGTGCG
GGCGGCGGTGCCCATCCGGCGATCGCCGCTTTCGTGGCCGCGGCGACGACGGCGGTCGAA
CGCATGGCGGGTTCACGAGGCCCGGCCGGCGGCTCTGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000847 Transcription regulator HTH, LysR (Domain)
 [5-63]  3.7e-15 PF00126
PF00126   HTH_1
 [2-59]  PS50931
PS50931   HTH_LYSR
IPR005119 LysR, substrate-binding (Domain)
 [88-297]  2.29999999999998e-35 PF03466
PF03466   LysR_substrate
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [3-85]  4.40000000000001e-20 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-32]  0.086 Signal
Bacteria, Gram-negative   
TMHMM No significant hit