close all open/close all

CDS information : Monen_00050


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction4,307 / 3,684 / - [in whole cluster]
4,307 / 3,684 / - [in contig]
Locationcomplement(3684..4307) [in whole cluster]
complement(3684..4307) [in contig]
TypeCDS
Length624 bp (207 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • SCN_5
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MAVAACAAVVLPIDAVVRISAADVGVLVFFAYLLPYLAITMTVFVSVAPEQVRSWARREA
RGTFLQRYVLGTAPGPGGSLFIAAAALVVAVLWLPGHLSTTFSALPRTLVALALVVAAWI
CVVVAFAVTFQADNLVENERALEFPGERSPAWADYVYFALAAMTTFGTTDVDVTSRDMRR
TVAANTVIAFVFNTVTVAILVSALGGR
selected fasta
>hypothetical protein [hypothetical protein]
CTGGCCGTCGCGGCGTGCGCGGCAGTGGTCCTCCCCATCGACGCCGTGGTGCGGATTTCG
GCAGCGGATGTCGGCGTGCTCGTCTTCTTCGCCTACCTGCTGCCCTACCTCGCCATCACC
ATGACCGTCTTCGTGAGCGTCGCTCCGGAGCAGGTCCGCTCCTGGGCGCGGCGCGAAGCC
CGCGGCACATTCCTGCAGCGTTACGTCCTCGGAACCGCGCCCGGCCCCGGGGGTTCGCTC
TTCATCGCGGCTGCCGCGCTGGTGGTGGCGGTGCTGTGGCTTCCCGGCCACCTCAGCACC
ACCTTCTCCGCGCTCCCCCGCACCCTGGTGGCGCTCGCCCTGGTCGTCGCCGCCTGGATC
TGCGTGGTCGTGGCCTTCGCCGTCACCTTCCAGGCCGACAACCTCGTGGAGAACGAGCGG
GCACTGGAATTCCCCGGGGAGCGGAGTCCCGCCTGGGCCGACTACGTCTATTTCGCCCTG
GCCGCGATGACGACGTTCGGCACCACCGATGTCGACGTCACCTCACGCGACATGCGACGG
ACCGTGGCGGCGAACACGGTCATCGCCTTCGTCTTCAACACCGTCACGGTCGCCATCCTG
GTGTCCGCACTGGGCGGCCGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009781 Protein of unknown function DUF1345 (Family)
 [17-199]  2.70000000000002e-44 PF07077
PF07077   DUF1345
SignalP
 [1-21]  0.952 Signal
Eukaryota   
TMHMM
 [26-48]  Transmembrane (o-i) [68-93]  Transmembrane (i-o) [108-130]  Transmembrane (o-i) [182-204]  Transmembrane (i-o)
Transmembrane 4