close all open/close all

CDS information : Monen_00080


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction6,010 / 5,693 / - [in whole cluster]
6,010 / 5,693 / - [in contig]
Locationcomplement(5693..6010) [in whole cluster]
complement(5693..6010) [in contig]
TypeCDS
Length318 bp (105 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)acyl carrier protein
GeneacpX
Gene (GenBank)
EC number
Keyword
  • modification base
Note
  • It is proposed that this module is not involved in the extension of polyketide chain, but provides a base for modification.
Note (GenBank)
  • SCN_8
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
Q27W65
NITE
Niger_00100
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)

close this sectionPKS/NRPS Module

13
ACP27..97

close this sectionSequence

selected fasta
>polyketide synthase [acyl carrier protein]
MTSTDHTSGQDATELEKQLAAATPEEREKLLTDTIRTQAGTLLNTTLSDDSNFLENGLNS
LTALELTKTLMTLTGMEIAMVAIVENPTPAQLAHHLGQELAHTTA
selected fasta
>polyketide synthase [acyl carrier protein]
ATGACCAGCACCGACCACACCTCCGGCCAGGACGCCACCGAGCTGGAGAAGCAGCTCGCC
GCGGCCACCCCCGAGGAGCGCGAGAAGCTCCTCACCGACACCATCCGCACCCAGGCCGGC
ACCCTTCTGAACACCACCCTCAGCGACGACAGCAACTTCCTCGAGAACGGTCTCAACTCC
CTCACCGCCCTTGAGCTCACCAAGACACTGATGACGCTGACCGGGATGGAGATCGCGATG
GTCGCCATCGTCGAGAACCCCACGCCCGCACAGCTCGCCCACCACCTCGGCCAGGAACTG
GCACACACCACCGCGTGA
[13] ACP27..97
[13] ACP79..291

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [21-101]  4.6e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [34-96]  2.6e-09 PF00550
PF00550   PP-binding
 [24-100]  4.30000170645867e-12 SSF47336
SSF47336   ACP_like
 [27-97]  PS50075
PS50075   ACP_DOMAIN
SignalP No significant hit
TMHMM No significant hit