close all open/close all

CDS information : Monen_00090


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction8,531 / 6,045 / - [in whole cluster]
8,531 / 6,045 / - [in contig]
Locationcomplement(6045..8531) [in whole cluster]
complement(6045..8531) [in contig]
TypeCDS
Length2,487 bp (828 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)ketosynthase-like protein
GeneksX
Gene (GenBank)
EC number
Keyword
  • modification base
Note
  • It is proposed that this module is not involved in the extension of polyketide chain, but provides a base for modification.
Note (GenBank)
  • SCN_9
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
Q27W64
NITE
Niger_00110
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)

close this sectionPKS/NRPS Module

13
KS34..401
at632..694

close this sectionSequence

selected fasta
>polyketide synthase [ketosynthase-like protein]
MANEEKLVEYLKWTTAELHQAQQQLRELKAAQHEPIAVVSMACRLPGKTRTPDDLWDLVS
EGRDAVTGFPDDRAWELPEERPYAELGGFLDDAAGFDAGFFDISDTEAVATEPLQRLMLH
LAWETVERGHIAPHTLRSTLTGVYVGATGHDYATRLETAPDELLPYLGGGTSGSLVSGRI
AYALGLEGPAISVDTACSSSLVALHLACQALRRGECGLALAGGGTVMSTPHTFHAFAHQK
SLAQDGRCKPFAAAADGMGLGEGVGLVLLERLGDARKNGHPVLAVIRGSAVNQDGAGYGL
AAPNGPSQQHVIRAALADAGLTPDQIDAVEAHGTGTPIGDAIEVQALLATYGADRSPDRP
LWLGSVKSNTGHTQGAAGAAALIKMVQAFRHGTLPPTLHVDRPTPLAAWKKGAVRLLTEA
VDWPRREEPRRVGISAFATSGTNAHLILEEPPVDEAPVPDAARDQTSPVAPELPVAWSLS
ARTPEALRAQAKALVTHLAATDPAPSPAEVAYSLAATRSPLEHRAVLTGTDHTELLAAAR
ALAAGEDHPDLVRSTPGAGPKKIAWHFDGRPADGVTTGAAPGAKPGATFGATFGAAFGGA
EFHSAFPLFASAFDEARALLDTHLPTPLPTPHSELARFAVHTALARLLLETGVRPHTLTG
DGVGHIAAAYAAGILTLDDACRLAAAHAAAAQAAEGEQPAPPDAYEPVLKQLTFQRATLT
LTSTAPADTPIASADYWHHHLTSPAPTAPPTPETHTLLHLGALSPEGTQTSAVSALLTAL
ARLHTTGGTVDWTPLVRRTPHPRTIDLPTYSFQATRYWLHDHTAHAAV
selected fasta
>polyketide synthase [ketosynthase-like protein]
GTGGCGAACGAAGAGAAGCTCGTCGAATACCTCAAGTGGACGACGGCCGAGCTCCACCAG
GCCCAGCAGCAGCTGCGCGAACTGAAGGCCGCACAGCACGAGCCGATCGCCGTCGTCTCC
ATGGCCTGCCGGCTGCCCGGCAAGACCCGCACCCCGGACGACCTGTGGGATCTGGTGTCC
GAGGGCCGCGACGCCGTCACCGGCTTCCCCGACGACCGCGCCTGGGAACTCCCCGAGGAA
CGCCCGTACGCGGAGCTCGGCGGGTTCCTGGACGACGCGGCCGGCTTCGACGCGGGCTTC
TTCGACATCAGCGACACCGAGGCCGTGGCCACCGAACCCCTCCAGCGCCTCATGCTCCAC
CTCGCGTGGGAGACCGTCGAACGCGGCCACATCGCCCCGCACACCCTGCGCTCCACCCTC
ACCGGCGTCTACGTCGGCGCCACCGGGCACGACTACGCGACACGGCTCGAGACCGCGCCC
GACGAGCTGCTGCCCTATCTGGGCGGCGGCACGTCCGGCAGCCTCGTCTCCGGCCGCATC
GCCTACGCCCTCGGCCTCGAGGGCCCCGCCATCAGCGTGGACACGGCCTGCTCGTCCTCC
CTGGTCGCCCTCCACCTGGCCTGCCAGGCGCTGCGCCGCGGGGAGTGCGGCCTCGCCCTC
GCCGGCGGCGGCACCGTCATGTCGACGCCGCACACCTTCCACGCCTTCGCCCACCAGAAG
TCGCTCGCGCAGGACGGCCGTTGCAAACCGTTCGCCGCCGCGGCCGACGGCATGGGCCTC
GGTGAAGGCGTCGGCCTCGTCCTGCTTGAGCGGCTCGGCGACGCCAGGAAGAACGGCCAC
CCGGTGCTCGCCGTCATCCGCGGCTCCGCGGTCAACCAGGACGGCGCCGGATACGGCCTC
GCCGCCCCCAACGGCCCCTCCCAGCAGCATGTGATCCGCGCCGCCCTCGCCGACGCCGGG
CTCACCCCGGACCAGATCGACGCCGTCGAGGCGCACGGGACGGGCACCCCCATCGGCGAC
GCCATCGAGGTCCAGGCCCTCCTCGCCACCTACGGCGCCGACCGCTCCCCCGACCGGCCC
CTGTGGCTCGGCTCCGTCAAGTCCAACACGGGGCACACGCAGGGGGCCGCGGGTGCGGCC
GCGCTCATCAAGATGGTCCAGGCGTTCCGGCACGGCACCCTGCCGCCGACCCTCCACGTC
GACCGCCCGACGCCCCTCGCCGCCTGGAAGAAGGGCGCGGTACGGCTGCTCACCGAGGCG
GTCGACTGGCCCCGCCGCGAGGAGCCCCGCCGGGTCGGCATCTCCGCCTTCGCCACGTCC
GGCACGAACGCGCACCTCATCCTCGAAGAGCCGCCGGTGGACGAGGCTCCGGTGCCGGAT
GCCGCCCGCGACCAGACGTCGCCCGTTGCCCCGGAACTCCCGGTGGCCTGGAGCCTGTCC
GCTCGTACACCCGAGGCCCTGCGGGCACAGGCGAAGGCCCTCGTCACCCACCTGGCGGCC
ACCGACCCCGCGCCCTCCCCCGCCGAGGTCGCCTACTCGCTCGCCGCCACCCGCAGCCCC
CTGGAACACCGCGCCGTCCTCACCGGCACCGACCACACCGAACTCCTCGCCGCCGCCCGC
GCCCTGGCCGCCGGAGAGGACCACCCGGACCTGGTCAGGTCCACGCCCGGGGCCGGCCCG
AAGAAGATCGCCTGGCACTTCGACGGCCGCCCGGCCGACGGGGTGACGACGGGGGCGGCA
CCCGGAGCCAAACCCGGCGCGACATTCGGCGCTACATTCGGCGCGGCTTTCGGAGGTGCC
GAGTTCCACTCGGCGTTCCCGCTCTTCGCGTCCGCCTTCGACGAAGCGCGCGCGCTCCTC
GACACCCATCTGCCGACTCCCCTCCCCACTCCCCACTCCGAACTGGCGCGCTTCGCGGTC
CACACCGCGCTCGCGCGGCTGCTCCTGGAAACGGGGGTACGCCCCCACACCCTCACCGGC
GACGGTGTCGGCCACATCGCCGCCGCGTACGCCGCGGGAATCCTGACCCTCGACGACGCG
TGCCGCCTGGCCGCCGCCCACGCCGCTGCCGCCCAGGCCGCCGAGGGTGAACAACCGGCT
CCGCCCGACGCCTACGAGCCCGTGCTGAAGCAGCTGACGTTCCAACGCGCCACGCTCACG
CTCACCAGCACTGCCCCGGCCGACACCCCCATCGCCTCCGCCGACTACTGGCACCACCAC
CTCACCTCGCCGGCCCCCACCGCACCCCCCACCCCCGAGACCCACACGCTTCTCCACCTG
GGCGCGCTCTCACCGGAAGGCACGCAAACCTCCGCCGTAAGCGCCCTGTTGACCGCCCTC
GCGCGGCTTCACACCACGGGCGGCACCGTCGACTGGACCCCTCTCGTCCGGCGCACCCCC
CACCCCCGGACCATCGACCTCCCGACGTACTCCTTCCAGGCCACGCGTTACTGGCTGCAC
GACCACACCGCGCACGCCGCGGTGTGA
[13] KS34..401
[13] at632..694
[13] KS100..1203
[13] at1894..2082

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [629-744]  8.1e-17 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-275]  2.79999999999994e-76 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [283-401]  1.70000000000001e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [632-694]  4.20000000000001e-06 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  2.8e-15 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [592-744]  8.80000265836278e-15 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016038 Thiolase-like, subgroup (Domain)
 [36-287]  3.19999999999996e-80 G3DSA:3.40.47.10 [288-452]  2.4e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-399]  1e-94 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [188-204]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-453]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit