close all open/close all

CDS information : Monen_00100


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction9,542 / 8,643 / - [in whole cluster]
9,542 / 8,643 / - [in contig]
Locationcomplement(8643..9542) [in whole cluster]
complement(8643..9542) [in contig]
TypeCDS
Length900 bp (299 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productthioesterase
Product (GenBank)monensin cyclase
Gene
Gene (GenBank)monCII
EC number
Keyword
  • unusual type
Note
Note (GenBank)
  • monensin epoxide hydrolase; MonCII
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
[16897798] Evidence that a novel thioesterase is responsible for polyketide chain release during biosynthesis of the polyether ionophore monensin. (Chembiochem. , 2006)

close this sectionSequence

selected fasta
>thioesterase [monensin cyclase]
MKNLRIPVSQTVSLNVRYRPADGPGAPGRPFLLLHGMLSNARMWDEVAARLAAAGHPAYA
VDHRGHGESDTPPDGYDNATVVTDLVAAVTALDLSGALVAGHSWGAHLALRLAAEHPDLV
AGLALIDGGWYEFDGPVMRAFWERTADVVRRAQQGTTSAADMRAYLRATHPDWSPTSIEA
RLADYRVGPDGLLIPRLTSTQVMSIVAGLQREAPADWYPKVTVPVRLLPLIPAIPQLSDQ
VRAWVAAAEAALEQVSVRWYPGSDHDLHAGAPDEIAADLLLLARSCEAMPGGKAGVRPA
selected fasta
>thioesterase [monensin cyclase]
GTGAAGAACCTCCGCATCCCCGTGTCGCAGACCGTCTCCCTCAATGTCAGGTACCGGCCC
GCGGACGGGCCGGGAGCCCCGGGCCGTCCGTTCCTGCTGCTGCACGGCATGCTGTCGAAC
GCCCGGATGTGGGACGAGGTCGCCGCCCGTCTCGCCGCCGCCGGACACCCGGCCTACGCC
GTCGACCACCGCGGCCACGGCGAGTCGGACACCCCGCCCGACGGGTACGACAACGCGACG
GTCGTCACCGACCTGGTGGCGGCCGTCACCGCCCTCGACCTGTCCGGCGCACTGGTGGCC
GGGCACTCCTGGGGCGCGCACCTCGCGCTGCGCCTGGCGGCCGAGCACCCGGACCTGGTG
GCCGGTCTCGCCCTGATCGACGGCGGCTGGTACGAGTTCGACGGACCGGTGATGCGCGCC
TTCTGGGAGCGCACCGCCGACGTGGTCCGGCGCGCCCAGCAGGGCACCACCAGCGCCGCC
GACATGCGCGCCTACCTGCGGGCCACCCATCCCGACTGGTCGCCCACGTCCATCGAGGCA
CGCCTGGCGGACTACCGCGTCGGGCCGGACGGCCTGCTCATCCCCCGCCTGACCTCGACA
CAGGTCATGTCGATCGTCGCCGGCCTGCAACGGGAGGCACCGGCCGACTGGTATCCCAAG
GTCACCGTGCCGGTGCGGCTGCTGCCCCTCATCCCCGCCATCCCCCAACTGTCCGACCAG
GTACGGGCCTGGGTGGCCGCCGCCGAGGCGGCCCTGGAGCAGGTGAGCGTGCGCTGGTAC
CCGGGCTCCGACCACGATCTGCACGCCGGCGCACCCGACGAGATCGCCGCCGACCTCCTG
CTGCTGGCCCGCTCGTGCGAGGCGATGCCCGGCGGCAAGGCGGGAGTTAGACCCGCTTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit