close all open/close all

CDS information : Monen_00110


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction10,426 / 9,596 / - [in whole cluster]
10,426 / 9,596 / - [in contig]
Locationcomplement(9596..10426) [in whole cluster]
complement(9596..10426) [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)monensin 3-O-methyl transferase
Gene
Gene (GenBank)monE
EC number2.1.1.-
Keyword
  • C-3
Note
Note (GenBank)
  • SAM dependent; MonE
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
Q8KI52
PmId
[12619684] Characterization of the biosynthetic gene cluster of rebeccamycin from Lechevalieria aerocolonigenes ATCC 39243. (Biosci Biotechnol Biochem. , 2003)
ACC
O52570
NITE
Rifam_00560
PmId
[12623077] Isolation and characterization of 27-O-demethylrifamycin SV methyltransferase provides new insights into the post-PKS modification steps during the biosynthesis of the antitubercular drug rifamycin B by Amycolatopsis mediterranei S699. (Arch Biochem Biophys. , 2003)
ACC
Q9X5Q9
PmId
[10099135] Molecular characterization and analysis of the biosynthetic gene cluster for the antitumor antibiotic mitomycin C from Streptomyces lavendulae NRRL 2564. (Chem Biol. , 1999)
[11439066] Mapping the mitomycin biosynthetic pathway by functional analysis of the MitM aziridine N-methyltransferase. (J Am Chem Soc. , 2001)

close this sectionSequence

selected fasta
>putative O-methyltransferase [monensin 3-O-methyl transferase]
MNKTVAPEPSDIGHYYDHKVFDLMTQLGDGNLHYGYWFDGGEQQATFDEAMVQMTDEMIR
RLDPAPGDRVLDIGCGNGTPAMQLARARDVEVVGISVSARQVERGNRRAREAGLADRVRF
EQVDAMNLPFDDGSFDHCWALESMLHMPDKQQVLTEAHRVVKPGARMPIADMVYLNPDPS
RPRTATVSDTTIYAALTDIGDYPDIFRAAGWTVLELTDITRETAKTYDGYVEWIRAHRDE
YVDIIGVEGYELFLHNQAALGKMPELGYIFATAQRP
selected fasta
>putative O-methyltransferase [monensin 3-O-methyl transferase]
GTGAACAAGACCGTCGCCCCCGAGCCCAGCGACATCGGCCACTACTACGACCACAAGGTC
TTCGACCTGATGACTCAGCTCGGAGACGGCAATCTGCACTACGGCTACTGGTTCGACGGC
GGCGAGCAGCAGGCCACGTTCGACGAGGCCATGGTCCAGATGACCGACGAGATGATCCGC
CGCCTCGACCCGGCCCCCGGCGACCGCGTCCTCGACATCGGCTGCGGCAACGGCACCCCG
GCCATGCAGCTGGCCCGCGCCCGCGACGTCGAGGTGGTCGGCATCTCCGTCAGCGCCCGC
CAGGTCGAGCGCGGCAACCGCCGGGCGCGCGAGGCCGGCCTCGCCGACCGGGTCCGCTTC
GAGCAGGTCGACGCCATGAACCTGCCGTTCGACGACGGCTCCTTCGACCACTGCTGGGCC
CTGGAGTCCATGCTGCACATGCCGGACAAGCAGCAGGTGCTCACCGAGGCCCACCGCGTC
GTGAAGCCCGGCGCGCGGATGCCGATCGCCGACATGGTCTACCTCAACCCCGATCCCAGC
CGGCCCCGGACCGCCACCGTCAGCGACACCACGATCTACGCCGCGCTCACCGACATCGGG
GACTACCCCGACATCTTCCGCGCCGCCGGCTGGACCGTCCTCGAACTGACCGACATCACC
CGCGAGACCGCCAAGACCTACGACGGTTACGTCGAGTGGATCCGCGCCCACCGGGACGAG
TACGTCGACATCATCGGCGTAGAGGGATACGAGCTGTTCCTGCACAACCAGGCGGCCCTC
GGCAAGATGCCCGAGCTCGGATACATCTTCGCGACCGCGCAGCGCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [71-166]  1.6e-21 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit