close all open/close all

CDS information : Monen_00120


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction10,656 / 12,191 / + [in whole cluster]
10,656 / 12,191 / + [in contig]
Location10656..12191 [in whole cluster]
10656..12191 [in contig]
TypeCDS
Length1,536 bp (511 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative monensin resistance protein
Gene
Gene (GenBank)monT
EC number
Keyword
Note
Note (GenBank)
  • membrane transporter; putative monensin transporter; MonT
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
Q9XE01
NITE
Virg_00360
PmId
[10322037] Identification and in vivo functional analysis of a virginiamycin S resistance gene (varS) from Streptomyces virginiae. (J Bacteriol. , 1999)
[11222601] Identification of the varR gene as a transcriptional regulator of virginiamycin S resistance in Streptomyces virginiae. (J Bacteriol. , 2001)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative monensin resistance protein]
MSADLGARRWWAVGALVLASMVVGFDVTILSLALPAMADDLGANNVELQWFVTSYTLVFA
AGMIPAGMLGDRFGRKKVLLTALVIFGIASLACAYATSSGTFIGARAVLGLGAALIMPTT
LSLLPVMFSDEERPKAIGAVAGAAMLAYPLGPILGGYLLNHFWWGSVFLINVPVVILAFL
AVSAWLPESKAKEAKPFDIGGLVFSSVGLAALTYGVIQGGEKGWTDVTTLVPCIGGLLAL
VLFVMWEKRVADPLVDLSLFRSARFTSGTMLGTVINFTMFGVLFTMPQYYQAVLGTDAMG
SGFRLLPMVGGLLVGVTVANKVAKALGPKTAVGIGFALLAAALFYGATTDVSSGTGLAAA
WTAAYGLGLGIALPTAMDAALGALSEDSAGVGSGVNQSIRTLGGSFGAAILGSILNSGYR
GKLDLDGVPEQAHGAVKDSVFGGLAVARAIKSNGLADSVRSAYVHALDVVLVVSGGLGLL
GVVLAVVWLPRHVGQSTAKTAESEHEAADAV
selected fasta
>putative drug resistance transporter [putative monensin resistance protein]
ATGTCTGCTGATCTGGGTGCGCGGCGGTGGTGGGCCGTCGGTGCTCTCGTACTCGCCTCG
ATGGTCGTGGGCTTCGATGTGACGATCCTGAGCCTGGCGTTGCCCGCCATGGCCGACGAC
CTCGGCGCGAACAACGTCGAGCTGCAGTGGTTCGTGACGTCGTACACGCTGGTGTTCGCG
GCCGGCATGATCCCGGCCGGCATGCTCGGTGACCGGTTCGGACGCAAGAAGGTCCTGCTC
ACCGCCCTGGTGATCTTCGGTATCGCCTCGCTGGCCTGTGCCTACGCGACGTCCTCCGGC
ACCTTCATCGGCGCGCGTGCGGTGCTCGGTCTGGGCGCCGCGCTGATCATGCCGACGACG
CTGTCGCTGCTGCCGGTCATGTTCTCCGACGAGGAGCGGCCGAAGGCCATCGGAGCGGTG
GCCGGTGCGGCGATGCTCGCCTATCCGCTCGGCCCGATCCTCGGCGGCTACCTGCTCAAC
CACTTCTGGTGGGGCTCCGTCTTCCTGATCAACGTGCCGGTGGTGATCCTCGCCTTCCTC
GCGGTCTCCGCCTGGCTGCCCGAGTCCAAGGCCAAGGAGGCCAAGCCGTTCGACATCGGC
GGCCTGGTGTTCTCCAGCGTCGGTCTCGCCGCGCTGACCTACGGCGTGATCCAGGGCGGC
GAGAAGGGCTGGACGGACGTCACCACGCTGGTGCCGTGCATCGGCGGTCTGCTCGCCCTC
GTGCTGTTCGTGATGTGGGAGAAGCGGGTGGCGGACCCGCTGGTCGACCTCTCGCTGTTC
CGCTCGGCCCGGTTCACCTCCGGCACCATGCTCGGCACCGTCATCAACTTCACGATGTTC
GGCGTGCTCTTCACGATGCCGCAGTACTACCAGGCGGTCCTCGGCACCGACGCGATGGGC
AGCGGCTTCCGGCTGCTCCCGATGGTCGGCGGTCTGCTCGTGGGTGTGACGGTCGCCAAC
AAGGTCGCCAAGGCCCTCGGCCCGAAGACCGCGGTCGGCATCGGCTTCGCCCTCCTCGCC
GCCGCCCTGTTCTACGGCGCCACCACGGACGTCAGCAGCGGCACCGGCCTGGCGGCCGCC
TGGACCGCGGCCTACGGACTCGGCCTCGGCATCGCCCTGCCGACCGCCATGGACGCCGCC
CTCGGCGCGCTCTCCGAGGACTCCGCCGGCGTCGGATCCGGCGTCAACCAGTCCATCCGT
ACCCTCGGCGGCAGCTTCGGCGCGGCCATCCTCGGTTCCATCCTCAACTCCGGCTACCGC
GGCAAGCTCGACCTCGACGGCGTGCCCGAGCAGGCACACGGCGCGGTCAAGGACTCCGTC
TTCGGCGGCCTCGCGGTGGCCCGGGCGATCAAGTCCAACGGACTGGCCGACTCGGTGCGT
TCCGCGTACGTCCACGCCCTGGACGTGGTGCTCGTGGTCTCCGGCGGCCTCGGACTGCTG
GGTGTGGTGCTGGCGGTGGTGTGGCTGCCCCGCCATGTTGGTCAGAGCACCGCCAAGACA
GCAGAATCTGAGCATGAAGCCGCAGACGCAGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [13-417]  2.90000000000003e-80 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [16-408]  3.99999999999998e-52 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-505]  9.69997533354407e-77 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [12-493]  PS50850
PS50850   MFS
SignalP
 [1-38]  0.884 Signal
Bacteria, Gram-negative   
 [1-24]  0.95 Signal
Eukaryota   
 [1-38]  0.976 Signal
Bacteria, Gram-positive   
TMHMM
 [12-34]  Transmembrane (i-o) [49-71]  Transmembrane (o-i) [78-97]  Transmembrane (i-o) [102-124]  Transmembrane (o-i) [137-159]  Transmembrane (i-o) [164-186]  Transmembrane (o-i) [199-217]  Transmembrane (i-o) [227-244]  Transmembrane (o-i) [265-287]  Transmembrane (i-o) [302-319]  Transmembrane (o-i) [326-348]  Transmembrane (i-o) [363-385]  Transmembrane (o-i) [398-415]  Transmembrane (i-o) [467-489]  Transmembrane (o-i)
Transmembrane 14