close all open/close all

CDS information : Monen_00130


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction12,205 / 12,780 / + [in whole cluster]
12,205 / 12,780 / + [in contig]
Location12205..12780 [in whole cluster]
12205..12780 [in contig]
TypeCDS
Length576 bp (191 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)putative monensin cluster negative regulator
Gene
Gene (GenBank)monRII
EC number
Keyword
Note
Note (GenBank)
  • putative repressor; DNA binding protein; MonRII
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
P39885
PmId
[1592820] The Streptomyces glaucescens TcmR protein represses transcription of the divergently oriented tcmR and tcmA genes by binding to an intergenic operator region. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative monensin cluster negative regulator]
MPGLRERKKARTKAAIQREAVRLFREQGYTATTIEQIAEAAEVAPSTVFRYFATKQDLVF
SHDYDLPFAMMVQAQSPDLTPIQAERQAIRSMLQDISEQELALQRERFVLILSEPELWGA
SLGNIGQTMQIMSEQVAKRAGRDPRDPAVRAYTGAVFGVMLQVSMDWANDPDMDFATTLD
EALHYLEDLRP
selected fasta
>putative TetR family transcriptional regulator [putative monensin cluster negative regulator]
GTGCCTGGTCTGAGAGAACGCAAGAAGGCCCGGACGAAGGCCGCGATTCAGCGGGAGGCG
GTGCGCTTGTTCAGGGAACAGGGCTACACCGCCACGACCATCGAGCAGATCGCCGAAGCC
GCCGAGGTCGCTCCCAGCACCGTCTTCCGCTACTTCGCGACCAAGCAGGACCTGGTCTTC
TCGCACGACTACGATCTGCCCTTCGCGATGATGGTCCAGGCCCAGTCACCCGACCTGACG
CCGATCCAGGCCGAGCGGCAGGCCATCCGCTCGATGTTGCAGGACATCAGCGAGCAGGAA
CTGGCCCTGCAGCGCGAGCGGTTCGTCCTGATTCTCTCCGAGCCGGAGCTCTGGGGCGCC
AGCCTCGGCAACATCGGCCAGACCATGCAGATCATGAGTGAGCAGGTGGCCAAACGGGCC
GGGCGCGACCCGCGGGACCCCGCGGTCCGCGCCTACACCGGAGCCGTGTTCGGAGTGATG
CTCCAGGTCTCGATGGACTGGGCCAACGATCCGGACATGGACTTCGCGACCACGCTGGAC
GAGGCACTCCACTACCTGGAAGACCTGCGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [10-70]  PS50977
PS50977   HTH_TETR_2
 [16-29]  4.69999810630989e-07 PR00455 [37-60]  4.69999810630989e-07 PR00455
PR00455   HTHTETR
 [17-59]  1.8e-15 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [1-60]  3.0999994589937e-14 SSF46689
SSF46689   Homeodomain_like
 [4-56]  6.90000000000001e-19 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [57-188]  9.10000000000001e-31 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit