close all open/close all

CDS information : Monen_00140


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction13,829 / 13,023 / - [in whole cluster]
13,829 / 13,023 / - [in contig]
Locationcomplement(13023..13829) [in whole cluster]
complement(13023..13829) [in contig]
TypeCDS
Length807 bp (268 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)PKS thioesterase
Gene
Gene (GenBank)monAIX
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • MonAIX
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>putative type II thioesterase [PKS thioesterase]
MDRGTAARAPQIGDEFGAATGNGVWLRRYHAAAEAPVRLVCFPFAGGSASYYFGLSGLLA
PGVEVLAVQYPGRQDRHAEPCLASVAELADGVVPHLPCDGKPFALFGHSLGAIVAFEVAR
RLRGPAGPGLPVHLFVSGGLARPYRPAGRSGAFGDADILAHLRAMGGTDERFFRSPELQE
LVLPALRADYRAVATYEAPGPGRLDCPITALIGDADERTSPEQAATWRERTGAAFDLRVL
PGGHFYLDGCQEQVAAVVTEALTAGPGV
selected fasta
>putative type II thioesterase [PKS thioesterase]
ATGGACAGGGGCACGGCGGCGCGGGCACCACAGATCGGTGACGAGTTCGGTGCAGCCACC
GGAAACGGGGTGTGGTTGCGGCGGTACCACGCTGCGGCAGAGGCGCCGGTGCGGCTGGTC
TGCTTTCCGTTCGCGGGCGGTTCGGCGAGTTACTACTTCGGGCTCTCCGGGCTGCTCGCG
CCCGGCGTCGAGGTGCTCGCCGTGCAGTATCCGGGGCGGCAGGACCGTCATGCGGAGCCG
TGCCTGGCGTCGGTGGCCGAGCTCGCCGACGGCGTCGTGCCCCACCTGCCGTGCGACGGG
AAGCCATTCGCGCTGTTCGGGCACAGCCTGGGCGCCATCGTGGCGTTCGAGGTGGCGCGG
CGGCTGCGGGGACCGGCCGGGCCCGGCCTTCCCGTGCACCTGTTCGTTTCCGGGGGGCTC
GCGCGGCCCTACCGTCCCGCGGGGCGTTCGGGGGCGTTCGGGGACGCGGACATCCTGGCC
CATCTGCGGGCGATGGGCGGCACCGACGAGCGGTTCTTCCGCAGTCCCGAGCTGCAGGAG
CTCGTCCTGCCCGCGCTGCGGGCCGACTACCGGGCCGTGGCCACCTACGAGGCGCCGGGA
CCCGGCCGGCTCGACTGCCCGATCACGGCGCTGATCGGGGACGCCGACGAGCGGACGTCG
CCGGAGCAGGCCGCCACGTGGCGGGAGCGGACCGGCGCGGCGTTCGATCTGCGGGTGCTG
CCCGGCGGGCACTTCTACCTCGACGGCTGTCAGGAGCAGGTGGCGGCCGTCGTGACCGAG
GCGCTGACGGCGGGGCCGGGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [38-251]  1.9e-44 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit