close all open/close all

CDS information : Monen_00150


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction14,121 / 23,198 / + [in whole cluster]
14,121 / 23,198 / + [in contig]
Location14121..23198 [in whole cluster]
14121..23198 [in contig]
TypeCDS
Length9,078 bp (3,025 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)monensin polyketide synthase loading module and module 1
Gene
Gene (GenBank)monAI
EC number
Keyword
Note
Note (GenBank)
  • monensin PKS module L and 1; MonAI
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
[11774001] Engineering of complex polyketide biosynthesis--insights from sequencing of the monensin biosynthetic gene cluster. (J Ind Microbiol Biotechnol. , 2001)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 methylmalonyl-CoA
KSQ17..381
AT553..899
ACP977..1050
KS1079..1455
AT1615..1930
dh1978..2167
kr2508..2721
ACP2818..2888

close this sectionSequence

selected fasta
>polyketide synthase [monensin polyketide synthase loading module and module 1]
MAASASASPSGPSAGPDPIAVVGMACRLPGAPDPDAFWRLLSEGRSAVSTAPPERRRADS
GLHGPGGYLDRIDGFDADFFHISPREAVAMDPQQRLLLELSWEALEDAGIRPPTLARSRT
GVFVGAFWDDYTDVLNLRAPGAVTRHTMTGVHRSILANRISYAYHLAGPSLTVDTAQSSS
LVAVHLACESIRSGDSDIAFAGGVNLICSPRTTELAAARFGGLSAAGRCHTFDARADGFV
RGEGGGLVVLKPLAAARRDGDTVYCVIRGSAVNSDGTTDGITLPSGQAQQDVVRLACRRA
RITPDQVQYVELHGTGTPVGDPIEAAALGAALGQDAARAVPLAVGSAKTNVGHLEAAAGI
VGLLKTALSIHHRRLAPSLNFTTPNPAIPLADLGLTVQQDLADWPRPEQPLIAGVSSFGM
GGTNGHVVVAAAPDSVAVPEPVGVPERVEVPEPVVVSEPVVVPTPWPVSAHSASALRAQA
GRLRTHLAAHRPTPDAARVGHALATTRAPLAHRAVLLGGDTAELLGSLDALAEGAETASI
VRGEAYTEGRTAFLFSGQGAQRLGMGRELYAVFPVFADALDEAFAALDVHLDRPLREIVL
GETDSGGNVSGENVIGEGADHQALLDQTAYTQPALFAIETSLYRLAASFGLKPDYVLGHS
VGEIAAAHVAGVLSLPDASALVATRGRLMQAVRAPGAMAAWQATADEAAEQLAGHERHVT
VAAVNGPDSVVVSGDRATVDELTAAWRGRGRKAHHLKVSHAFHSPHMDPILDELRAVAAG
LTFHEPVIPVVSNVTGELVTATATGSGAGQADPEYWARHAREPVRFLSGVRGLCERGVTT
FVELGPDAPLSAMARDCFPAPADRSRPRPAAIATCRRGRDEVATFLRSLAQAYVRGADVD
FTRAYGATATRRFPLPTYPFQRERHWPAAAGVGQQPETPELPESSESSEQAGHEREEGAR
AWGGPEGRLAGLSVNDQERVLLGLVTKHVAVVLGDASGTVQAARTFKQLGFDSMAAAELS
ERLGTETGLPLPATLTFDYPTPLAVAAHLRAELTGTPAPAGSAPATGALGAGDLGTDEDP
VAIVAMSCRYPGGAGTPEDLWRLVADGADAIGDFPTDRGWDLARLFHPDPDRSGTSCTRQ
GGFLYDAADFDAEFFDISPREALAVDPQQRLLLECAWEAFERAGLDPRALKGSPTGVFVG
MTGQDYGPRLHEPSQATDGYLLTGSTPSVASGRLSFSFGLEGPALTVDTACSSSLVTLHL
AAQALRRGECDLALAGGATVLATPGMFTEFSRQRGLAPDGRCKPFAAGADGTGWAEGVGL
VLLERLSEARRKGHAVLAVIRGSAINQDGASNGLTAPNGPSQQRVIRAALAAARLTADEV
DVVEAHGTGTTLGDPIEAQALLATYGQGRSAERPLWLGSVKSNIGHTQAAAGVAGVIKMV
MAMRHDLLPATLHVDEPSGHVDWSTGAVRLLTEPVVWPRGERPRRAAVSSFGISGTNAHL
VLEEAGQDEYVAGAADDAGPVDGAVLPWVVSGRTGAALREQARRLRELVTGGSADVSVSG
VGRSLVTTRAVFEHRAVVVGRDRDTLIGGLEALAAGDASPDVVCGVAGDVGPGPVLVFPG
QGSQWVGMGAQLLGESAVFAARIDACEQALSPYVDWSLTEVLRGDGRELSRVDVVQPVLW
AVMVSLAAVWADHGVTPAAVVGHSQGEIAAVVVAGALTLEDGAKIVALRSRALRQLSGGG
AMASLGVGQEQAAELVEGHPGVGIAAVNGPSSTVISGPPEQVAAVVADAEARELRGRVID
VDYASHSPQVDAITDELTHTLSGVRPTTAPVAFYSAVTGTRIDTAGLDTDYWVTNLRRPV
RFADAVTALLADGHRVFIEASSHPVLTLGLQETFEEAGVDAVTVPTLRREDGGRARLARS
LAQAFGAGCAVRWENWFPATGTSTVELPTYAFQRRRYWLEAPTGTQDAAGLGLAAAGHPL
LGAATEIADGDIRLLTGRISRHSHPWLAQHTLFGAAVVPASVLAEWALRAADEAGCPRVD
DLTLRTPLVLPETAGVQVQIVVGPADARDGHRDFHVYARPDGKDASEGEGIAEGEGASEG
EGASGGTDAPWTCHADGRLVAEPTGTASEDSPDTVWPPPGAEPVDLGDFYERAAATGVGY
GPVFTGLRALWRRDGELFAEAVLPQEAPETAGFGMHPALLDAALHPALLGERPAEEDKVW
LPFTLTGVTLWATGATSVRVRLTPLDDDPDASADGRAWRVGVSDPTGAEVLTCEALVAVA
AGRRELRAAGERVSDLYAVEWVPVPGPGPVGEGADFSGWAGLGECGERWECVGRVERWYE
DLDALGAAVEGGASVPSVVLATAAAAPGGAGDGAADALSAVRWTGALLDQWLADARFADA
RLVVITSGAVATGDDFLPDPAAAAVRGLVEQAQVRHPGRILLVDTEAGAGLGVGAGVDDA
LLEQAVAMALGADEPQLALRAGRVLAPRLTAPQDAAVTEAARPLDPDGTVLITGPAGAPV
ADLAEHLVRTGQCRHLLLLPGDGELEEMAEELRGLGATVDLSTADPADPTALAEVVAAVE
GDHPLTGVIHATGVVDAFDPGDSASDLMIDSASDSFAEAWSSRAGVTAALHTATAHLPLD
LFAVLSPAGADLGIARSAAAAGADAFSAALALRRHTTVTTDTTAPPRTTAPPRTTASPRT
TALSSSRTTGVALAYGPPTAPRPGIKGTAPGRIPVLLDAARAHGGGSPLLGARLAARALA
AESAAEGVAGLPAPLRALAVAAAAAGAPTRRTAADRKPPADWPARLAPLSAPEQLRLLID
AVRTHAAAVLGRTDPEALRGDATFKQLGLDSLTAVELRNRLVEDTGLRLPTALVFRYPTP
AAIAAHLRERLTSPSETTATQRSGGQTPAAGQASSALAPGGSAAGPPAADTVLSDLTRME
NTLSVLAAQLPHTETGEITTRLEALLTRWKTTNATANDSGDGNGGDDDAAERLKAASADQ
IFDFIDNELGVGHGTSRVTPTPKAG
selected fasta
>polyketide synthase [monensin polyketide synthase loading module and module 1]
ATGGCCGCATCCGCGTCAGCGTCCCCCTCGGGACCGAGCGCAGGACCCGACCCGATCGCC
GTCGTCGGGATGGCCTGCCGCCTGCCCGGAGCACCTGACCCCGACGCGTTCTGGCGGCTG
CTCAGCGAGGGGCGCAGCGCGGTGAGCACCGCACCGCCCGAGCGGCGGCGAGCCGACTCC
GGCCTCCACGGGCCGGGCGGCTACCTGGACCGGATCGACGGCTTCGACGCGGACTTCTTC
CACATCAGCCCGCGCGAGGCCGTGGCGATGGACCCCCAGCAGCGGCTGCTCCTCGAACTG
AGCTGGGAGGCCCTCGAAGACGCGGGCATCCGGCCGCCCACCCTGGCGCGCAGCCGCACC
GGCGTCTTCGTCGGCGCGTTCTGGGACGACTACACCGACGTCCTGAACCTGCGGGCGCCG
GGCGCCGTCACCCGCCACACCATGACCGGCGTGCACCGCAGCATTCTGGCCAACCGCATC
TCGTACGCGTACCACCTGGCCGGTCCGAGCCTCACCGTCGACACCGCACAGTCCTCCTCG
CTCGTCGCCGTCCACCTGGCCTGCGAGAGCATCCGCAGCGGCGACTCCGACATCGCCTTC
GCGGGCGGCGTCAACCTCATCTGCTCGCCGCGCACCACCGAGCTGGCCGCGGCCCGCTTC
GGCGGTCTCTCGGCCGCAGGCCGCTGCCACACCTTCGACGCCCGCGCCGACGGTTTCGTA
CGCGGCGAGGGCGGCGGCCTCGTGGTGCTCAAGCCCCTCGCGGCGGCACGGCGCGACGGC
GACACGGTGTACTGCGTGATCCGGGGGAGCGCCGTCAACAGCGACGGTACGACCGACGGA
ATCACCCTGCCCAGCGGGCAGGCGCAGCAGGACGTGGTGCGCCTCGCCTGCCGACGGGCG
CGGATCACGCCGGACCAGGTGCAGTACGTCGAACTGCACGGCACCGGCACGCCCGTCGGG
GACCCGATCGAGGCCGCCGCGCTCGGCGCCGCCCTCGGGCAGGACGCCGCCCGCGCCGTG
CCGCTGGCCGTCGGCTCCGCCAAGACGAACGTCGGCCACCTCGAAGCCGCCGCCGGAATC
GTCGGACTGCTCAAGACCGCCCTGAGCATCCACCACCGGCGGCTGGCGCCGAGCCTGAAC
TTCACCACCCCCAATCCGGCCATCCCGCTCGCCGACCTCGGCCTGACCGTCCAGCAGGAC
CTGGCCGACTGGCCGCGCCCCGAACAGCCCCTGATCGCCGGGGTGTCGTCCTTCGGCATG
GGCGGCACGAACGGTCACGTTGTCGTGGCGGCGGCGCCCGATTCGGTGGCGGTACCTGAG
CCGGTGGGGGTGCCTGAGCGGGTGGAAGTGCCTGAGCCGGTGGTGGTTTCTGAGCCGGTG
GTGGTGCCGACGCCATGGCCCGTGAGCGCTCACAGCGCTTCCGCGCTGCGCGCGCAGGCC
GGTCGCCTGCGGACGCACCTCGCCGCCCACCGCCCCACCCCCGACGCCGCGCGGGTCGGC
CACGCGCTCGCCACCACCCGTGCGCCCCTCGCCCACCGCGCGGTCCTGCTCGGCGGCGAC
ACCGCCGAACTGCTGGGCTCCCTGGACGCGCTGGCCGAGGGCGCGGAGACCGCGTCCATC
GTGCGCGGCGAGGCGTACACCGAGGGCAGGACGGCCTTCCTCTTCAGTGGGCAGGGAGCG
CAACGCCTCGGCATGGGGCGGGAGTTGTATGCCGTGTTCCCCGTCTTCGCCGACGCTCTC
GACGAGGCGTTCGCCGCCCTGGACGTACATCTGGACCGCCCACTGCGCGAGATCGTCTTG
GGCGAGACCGACTCGGGTGGGAACGTCTCGGGTGAGAATGTCATCGGCGAGGGTGCCGAC
CATCAGGCACTCCTCGACCAGACCGCCTACACCCAGCCCGCGCTCTTCGCGATCGAGACG
AGCCTGTACCGGCTGGCAGCCTCCTTCGGCCTGAAGCCGGACTACGTCCTCGGCCACTCG
GTCGGCGAGATCGCCGCCGCGCACGTCGCCGGTGTCCTCTCGTTGCCGGACGCGAGCGCT
CTGGTGGCCACGCGGGGACGGCTCATGCAGGCGGTTCGCGCGCCCGGCGCGATGGCCGCG
TGGCAGGCCACGGCGGACGAGGCGGCCGAACAGCTCGCCGGGCACGAGCGGCACGTCACC
GTGGCCGCCGTCAACGGCCCCGACTCCGTGGTCGTCTCCGGCGACCGCGCCACCGTCGAC
GAACTGACCGCCGCCTGGCGGGGACGCGGCCGCAAGGCCCACCACCTGAAGGTCAGCCAC
GCCTTCCACTCCCCGCACATGGACCCCATCCTCGACGAGCTGCGCGCGGTCGCCGCCGGC
CTGACCTTCCACGAGCCGGTCATTCCCGTCGTCTCCAACGTCACCGGTGAACTGGTGACC
GCGACCGCGACCGGGAGCGGCGCCGGGCAGGCCGACCCCGAGTACTGGGCGCGGCATGCG
CGCGAGCCCGTGCGGTTCCTGTCCGGGGTGCGGGGGCTGTGCGAGCGCGGGGTGACCACG
TTCGTCGAGCTCGGCCCGGACGCACCGCTGTCCGCGATGGCCCGCGACTGCTTCCCCGCC
CCCGCGGACCGGAGCCGTCCGCGCCCCGCCGCCATCGCCACATGCCGCCGCGGGCGCGAC
GAGGTGGCCACGTTCCTGAGGTCGCTGGCCCAGGCGTACGTCCGCGGCGCCGATGTCGAC
TTCACCCGGGCCTACGGCGCCACCGCCACGCGCCGCTTCCCCCTCCCCACGTATCCCTTC
CAGCGCGAGCGCCATTGGCCTGCCGCTGCCGGGGTGGGGCAGCAGCCGGAGACCCCGGAA
CTTCCGGAATCCTCGGAGTCCTCGGAGCAGGCAGGGCATGAGCGGGAGGAGGGGGCGCGC
GCGTGGGGCGGGCCTGAAGGGCGGCTTGCCGGGCTCTCCGTGAACGACCAGGAGCGGGTC
CTCCTCGGCCTGGTCACCAAGCACGTGGCCGTCGTGCTCGGGGACGCCTCGGGCACGGTA
CAAGCCGCCCGCACCTTCAAGCAGTTGGGCTTCGACTCGATGGCCGCCGCCGAGCTGAGC
GAACGGCTCGGCACGGAGACGGGCCTGCCGTTGCCCGCCACCCTCACCTTCGACTACCCG
ACCCCTCTGGCCGTCGCCGCGCACCTGCGCGCGGAGCTCACCGGTACGCCCGCCCCGGCC
GGCTCCGCGCCCGCCACGGGCGCCCTCGGCGCGGGTGACCTCGGCACGGACGAGGACCCG
GTCGCCATCGTGGCCATGAGCTGCCGCTATCCCGGCGGCGCAGGCACGCCCGAGGACCTG
TGGCGGCTGGTCGCGGACGGCGCCGACGCGATCGGAGACTTCCCCACCGACCGCGGCTGG
GACCTGGCGCGGCTGTTCCACCCCGACCCCGACCGGTCGGGCACCAGCTGCACGCGGCAG
GGCGGATTCCTGTACGACGCCGCCGACTTCGACGCCGAGTTCTTCGACATCAGCCCGCGC
GAGGCCCTGGCCGTCGACCCGCAGCAGCGGCTGCTCCTCGAGTGCGCCTGGGAGGCCTTC
GAACGGGCGGGCCTGGACCCGCGGGCGCTCAAGGGCAGCCCCACCGGCGTGTTCGTCGGC
ATGACGGGGCAGGACTACGGCCCCCGTCTGCACGAGCCGTCCCAGGCCACCGACGGCTAT
CTGCTGACCGGCAGCACGCCGAGCGTGGCCTCGGGCCGCCTGTCGTTCAGCTTCGGCCTT
GAGGGGCCCGCCCTGACGGTGGACACGGCCTGCTCGTCGTCGCTGGTCACGCTCCATCTC
GCGGCGCAGGCGCTGCGGCGCGGCGAGTGCGACCTGGCCCTCGCCGGCGGCGCCACCGTC
CTGGCCACGCCGGGCATGTTCACCGAGTTCTCGCGGCAGCGGGGCCTGGCCCCCGACGGC
CGCTGCAAGCCGTTCGCGGCGGGCGCCGACGGCACGGGCTGGGCCGAGGGCGTGGGCCTG
GTCCTCCTCGAAAGGCTCTCCGAGGCCCGGCGCAAGGGGCACGCCGTCCTCGCGGTGATC
CGGGGTTCGGCGATCAACCAGGACGGCGCGAGCAACGGCCTGACCGCGCCCAACGGCCCC
TCGCAGCAACGCGTCATCCGTGCCGCGCTCGCGGCCGCCCGGCTCACCGCGGACGAGGTC
GACGTAGTGGAGGCGCACGGCACCGGCACCACGCTCGGCGACCCGATCGAGGCGCAGGCC
CTGCTCGCCACGTACGGCCAAGGGCGTTCGGCGGAGCGGCCGTTGTGGCTCGGGTCGGTG
AAGTCGAACATCGGTCACACGCAGGCCGCCGCGGGTGTCGCGGGCGTCATCAAGATGGTG
ATGGCGATGCGCCACGACCTGCTCCCCGCCACCCTGCACGTCGACGAGCCGAGTGGCCAC
GTGGACTGGTCCACCGGCGCGGTGCGACTGCTCACCGAGCCGGTCGTCTGGCCGCGCGGC
GAACGTCCGCGCCGCGCCGCGGTGTCGTCCTTCGGCATCTCCGGCACGAACGCGCACCTG
GTGCTCGAAGAGGCGGGGCAGGACGAGTACGTTGCGGGAGCCGCCGACGACGCCGGGCCG
GTGGACGGTGCTGTGCTGCCGTGGGTGGTTTCCGGACGGACCGGAGCGGCGCTGCGCGAA
CAGGCCCGCCGTTTGCGTGAGTTGGTGACCGGCGGCTCGGCCGATGTCTCTGTGTCCGGG
GTGGGCCGGTCGCTGGTCACCACGCGGGCGGTGTTCGAGCACCGGGCCGTGGTCGTGGGC
CGCGACCGGGACACGCTGATCGGCGGCCTCGAGGCCCTTGCGGCGGGTGACGCGTCGCCG
GACGTCGTGTGCGGGGTCGCGGGCGATGTCGGCCCCGGCCCGGTGCTGGTGTTCCCCGGG
CAGGGCTCGCAGTGGGTGGGCATGGGAGCCCAACTCCTTGGCGAGTCCGCGGTGTTCGCG
GCGCGGATCGACGCGTGCGAGCAGGCGCTGTCCCCGTACGTCGACTGGTCACTGACAGAG
GTCCTGCGCGGGGACGGGCGCGAACTGTCGCGCGTCGACGTCGTCCAGCCCGTGCTGTGG
GCGGTGATGGTCTCGCTCGCCGCCGTCTGGGCGGACCACGGCGTCACCCCGGCCGCCGTC
GTCGGGCACTCCCAGGGAGAGATCGCCGCTGTGGTCGTCGCCGGCGCGCTCACCCTGGAG
GACGGCGCCAAGATCGTGGCCCTGCGCAGCCGGGCGCTGCGTCAGCTCTCGGGCGGGGGC
GCCATGGCCTCCCTCGGGGTGGGCCAGGAACAGGCAGCCGAACTCGTCGAGGGCCACCCC
GGAGTGGGCATCGCCGCCGTCAACGGCCCGTCATCGACCGTCATTTCAGGCCCGCCCGAG
CAAGTCGCCGCCGTCGTCGCCGACGCCGAGGCGCGCGAGCTGAGAGGCCGCGTCATTGAC
GTGGACTACGCCTCGCACAGCCCCCAGGTCGACGCCATCACCGACGAACTCACCCACACC
CTGTCCGGCGTCCGCCCCACCACGGCCCCGGTGGCGTTCTACTCGGCCGTGACCGGAACC
CGCATCGACACGGCGGGCCTCGACACCGACTACTGGGTCACCAACCTGCGCCGCCCGGTC
CGGTTCGCCGACGCCGTCACCGCGCTCCTCGCCGACGGCCACCGGGTCTTCATCGAGGCC
AGCAGCCACCCCGTCCTCACCCTCGGCCTCCAGGAGACCTTCGAGGAGGCCGGGGTCGAC
GCCGTCACCGTCCCCACCCTGCGGCGCGAGGACGGCGGCCGGGCACGCCTGGCCCGCTCG
CTGGCACAGGCCTTCGGCGCCGGGTGCGCGGTGAGGTGGGAGAACTGGTTTCCGGCCACC
GGTACGTCCACCGTGGAGCTGCCGACGTACGCCTTCCAGCGTCGCCGTTACTGGCTGGAG
GCCCCCACGGGCACCCAGGACGCGGCGGGCCTGGGCCTCGCCGCTGCGGGGCACCCGCTC
CTCGGGGCGGCCACCGAGATCGCGGACGGCGACATCCGCCTGCTCACCGGCCGTATCAGC
AGGCACAGCCACCCCTGGCTCGCTCAGCACACCCTCTTCGGTGCCGCGGTCGTGCCCGCC
TCCGTCCTCGCGGAATGGGCGCTGCGCGCCGCCGACGAGGCCGGCTGCCCGCGTGTCGAC
GACCTCACGCTGCGCACCCCGCTGGTGCTGCCCGAGACCGCGGGCGTGCAGGTGCAGATC
GTGGTCGGCCCGGCCGACGCGCGGGACGGGCACCGCGACTTCCACGTCTACGCCCGCCCC
GACGGCAAGGACGCCTCTGAGGGCGAGGGCATCGCCGAGGGCGAGGGTGCCTCTGAGGGC
GAGGGTGCCTCCGGCGGCACCGATGCGCCGTGGACCTGCCATGCCGACGGCCGACTGGTC
GCCGAGCCCACCGGCACGGCCTCGGAGGACTCCCCGGACACGGTGTGGCCGCCGCCCGGC
GCCGAACCCGTCGACCTGGGCGACTTCTACGAGCGGGCCGCCGCCACCGGAGTCGGCTAT
GGACCGGTCTTCACGGGGCTGCGCGCCCTGTGGCGGCGGGACGGCGAGCTGTTCGCCGAG
GCGGTGCTGCCGCAAGAAGCCCCGGAAACCGCCGGGTTCGGCATGCACCCGGCGCTCCTC
GACGCCGCACTGCACCCCGCACTCCTCGGCGAGCGGCCGGCCGAGGAGGACAAGGTGTGG
CTGCCGTTCACGCTGACCGGAGTGACCCTGTGGGCCACCGGTGCCACCTCTGTACGCGTC
CGTCTCACCCCGCTGGACGACGACCCCGACGCGTCGGCGGACGGGCGGGCCTGGCGGGTC
GGCGTGAGCGACCCGACCGGCGCGGAGGTGCTGACCTGCGAGGCCCTGGTCGCGGTGGCG
GCGGGCCGCCGCGAGCTGCGGGCCGCGGGGGAGCGGGTGTCCGATCTGTACGCGGTGGAG
TGGGTGCCGGTGCCGGGCCCGGGGCCGGTGGGTGAGGGTGCTGACTTCTCGGGCTGGGCC
GGTCTGGGGGAGTGCGGGGAGCGTTGGGAGTGCGTGGGGCGCGTGGAGCGCTGGTACGAG
GACCTGGACGCTCTCGGCGCGGCTGTCGAGGGTGGGGCTTCGGTGCCCTCTGTCGTTCTC
GCCACCGCGGCTGCCGCCCCTGGTGGAGCGGGCGACGGAGCCGCCGATGCGCTGAGCGCG
GTGCGGTGGACCGGCGCGCTCCTCGATCAGTGGCTCGCCGACGCGCGGTTCGCCGACGCC
CGGCTGGTGGTGATCACGTCCGGCGCGGTCGCCACGGGTGACGATTTCCTTCCCGACCCG
GCCGCCGCGGCGGTACGAGGACTGGTCGAGCAGGCGCAGGTCAGGCACCCCGGCCGCATC
CTCCTCGTCGACACGGAAGCCGGGGCCGGGCTCGGGGTCGGCGCCGGAGTGGATGACGCG
CTCCTGGAACAGGCCGTGGCCATGGCTCTCGGCGCCGACGAACCGCAACTCGCCCTGCGC
GCGGGGCGGGTCCTGGCGCCCCGCCTCACCGCACCCCAGGATGCGGCCGTCACCGAAGCG
GCGCGACCGCTCGACCCGGACGGCACCGTACTCATCACAGGGCCGGCCGGTGCTCCGGTG
GCCGACCTCGCCGAACACCTCGTACGCACCGGGCAGTGCAGGCATCTGCTGCTCCTGCCT
GGAGACGGTGAACTGGAGGAAATGGCCGAGGAGTTGCGGGGCCTCGGCGCCACCGTGGAC
CTGAGTACCGCCGACCCGGCGGACCCGACCGCCCTCGCCGAAGTGGTCGCCGCCGTCGAG
GGGGACCATCCTCTTACGGGGGTCATCCACGCCACCGGAGTCGTGGACGCGTTCGATCCC
GGCGACTCGGCGAGCGACTTGATGATCGACTCGGCGAGCGATTCGTTCGCCGAGGCATGG
TCGTCGAGGGCGGGCGTCACCGCCGCACTGCACACCGCGACCGCCCACCTTCCCCTGGAC
CTGTTCGCCGTCCTGTCCCCGGCGGGCGCGGACCTGGGCATTGCCCGGTCGGCGGCCGCC
GCGGGCGCCGACGCCTTCAGCGCGGCACTCGCCCTGCGCCGGCACACGACCGTCACGACG
GACACGACAGCCCCGCCGCGCACGACAGCCCCGCCGCGAACGACAGCCTCGCCGCGCACG
ACAGCCCTGTCGTCGTCGCGCACGACGGGCGTGGCCCTCGCCTACGGGCCGCCCACCGCG
CCGAGGCCCGGCATCAAGGGGACGGCGCCCGGTCGGATCCCCGTGCTGCTCGACGCCGCT
CGCGCTCACGGGGGCGGTTCGCCCCTGCTCGGGGCCCGCTTGGCCGCGCGTGCCCTGGCC
GCCGAGTCCGCCGCCGAGGGCGTCGCCGGCCTGCCCGCGCCGCTGCGCGCGCTGGCAGTG
GCCGCAGCCGCGGCCGGAGCACCGACCCGGCGCACCGCCGCCGACCGCAAGCCCCCCGCG
GACTGGCCGGCCCGACTGGCCCCCCTGTCCGCCCCCGAACAACTCCGTCTGCTCATCGAC
GCCGTACGCACCCACGCCGCCGCGGTCCTCGGCCGCACCGACCCGGAAGCGCTGCGCGGG
GACGCCACCTTCAAGCAGCTCGGCCTTGACTCGCTGACCGCCGTGGAGCTGCGCAACCGG
CTCGTGGAGGACACCGGTCTGCGCCTGCCCACCGCCCTCGTCTTTCGCTACCCGACCCCC
GCGGCGATCGCCGCGCACCTCCGCGAGCGGCTGACCAGCCCGAGCGAGACGACCGCCACA
CAGAGGTCCGGAGGGCAGACGCCCGCAGCGGGGCAGGCGTCGTCCGCGCTCGCCCCCGGC
GGATCGGCCGCCGGACCGCCCGCCGCAGACACCGTGCTGAGCGACCTGACCCGCATGGAG
AACACCCTCTCCGTGCTCGCCGCCCAGCTGCCCCACACCGAGACGGGTGAGATCACCACC
CGGCTCGAAGCGCTCCTCACGCGCTGGAAGACCACGAACGCCACGGCGAACGACAGCGGC
GACGGCAACGGCGGCGATGACGACGCCGCCGAACGCCTCAAGGCCGCGTCCGCCGACCAG
ATCTTCGACTTCATCGACAACGAGCTTGGTGTCGGGCACGGCACCTCGCGCGTGACCCCC
ACTCCGAAGGCCGGGTGA
[0] KSQ17..381
[0] AT553..899
[0] malonyl-CoA760..764
[0] ACP977..1050
[1] KS1079..1455
[1] AT1615..1930
[1] methylmalonyl-CoA1803..1807
[1] dh1978..2167
[1] kr2508..2721
[1] ACP2818..2888
[0] KSQ49..1143
[0] AT1657..2697
[0] malonyl-CoA2278..2292
[0] ACP2929..3150
[1] KS3235..4365
[1] AT4843..5790
[1] methylmalonyl-CoA5407..5421
[1] dh5932..6501
[1] kr7522..8163
[1] ACP8452..8664

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [541-692]  G3DSA:3.40.366.10 [760-888]  G3DSA:3.40.366.10 [1612-1736]  G3DSA:3.40.366.10 [1803-1919]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1008-1023]  PS00012 [2846-2861]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [974-1095]  1.50000306971104e-20 SSF47336 [2810-2905]  3.39999972437717e-22 SSF47336
SSF47336   ACP_like
 [977-1050]  PS50075 [2818-2888]  PS50075
PS50075   ACP_DOMAIN
 [981-1054]  2.29999999999998e-39 G3DSA:1.10.1200.10 [2818-2891]  2.29999999999998e-39 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [987-1049]  2.4e-07 PF00550 [2820-2887]  3.4e-13 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [2508-2679]  3.3e-21 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [17-256]  7.40000000000007e-81 PF00109 [1079-1329]  1.39999999999997e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [264-381]  1.5e-39 PF02801 [1337-1455]  5.19999999999996e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [553-899]  5.00000000000001e-69 PF00698 [1615-1930]  2.59999999999995e-101 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [550-876]  6.10002656149838e-71 SSF52151 [1613-1912]  6.29998179434732e-64 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [694-759]  1.79999754022375e-17 SSF55048 [1738-1802]  3.70000251046782e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [17-267]  G3DSA:3.40.47.10 [268-434]  4.59999999999996e-123 G3DSA:3.40.47.10 [1079-1340]  G3DSA:3.40.47.10 [1341-1506]  4.59999999999996e-123 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [16-434]  9.49996855930963e-86 SSF53901 [1078-1453]  4.69998262513189e-98 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1242-1258]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [554-879]  3.79997359309399e-122 SM00827 [1617-1911]  1.09999184471405e-117 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [982-1053]  1.60000240695997e-24 SM00823 [2819-2891]  1.99999636034521e-31 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1978-2167]  1.59998835313644e-78 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [19-434]  SM00825 [1081-1507]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2508-2721]  8.30001403791589e-32 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit