close all open/close all

CDS information : Monen_00160


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction23,205 / 29,921 / + [in whole cluster]
23,205 / 29,921 / + [in contig]
Location23205..29921 [in whole cluster]
23205..29921 [in contig]
TypeCDS
Length6,717 bp (2,238 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)monensin polyketide synthase module 2
Gene
Gene (GenBank)monAII
EC number
Keyword
Note
Note (GenBank)
  • MonAII
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionPKS/NRPS Module

2 methylmalonyl-CoA
KS34..408
AT564..881
DH927..1090
ER1445..1753
KR1763..1943
ACP2049..2119

close this sectionSequence

selected fasta
>polyketide synthase [monensin polyketide synthase module 2]
MASEEQLVEYLRRVTTELHDTRRRLVQEEDRRQEPVALVGMACRFPGGVASPEDLWDLVA
AGKDAIEDFPTDRGWDLEALYDPDPAAYGTSYVRHGGFVDDAGSFDADFFGISPREALAM
DPQQRLMLETSWELFERAGIEPVSLKGSRTGVYAGVSSEDYMSQLPRIPEGFEGHATTGS
LTSVISGRVAYNYGLEGPAVTVDTACSASLVAIHLASQALRQRECDLALAGGVLVLSSPL
MFTEFCRQRGLAPDGRCKPFAAAADGTGFSEGIGLLLLERLSDARRNGHKVLAVIRGSAV
NQDGASNGLTAPNDAAQEQVIRAALDNARLTPSEVDAVEAHGTGTKLGDPIEAGALLATY
GQHRARPLLLGSLKSNIGHTHATAGVAGVIKTVMAIRNGLLPATLHVEELSPHVDWDAGA
VEVVTEPTPWPETGHPRRAGVSAFGISGTNAHLILEEAPPEEDVPAPVVVESGGVVPWVV
SGRTPEALREQARRLGEFVAGDTDALPNEVGWSLATTRSVFEHRAVVVGRDRDALTAGLG
ALAAGEASAGVVAGVAGDVGPGPVLVFPGQGAQWVGMGAQLLDESAVFAARIAECERALS
AHVDWSLSAVLRGDGSELSRVEVVQPVLWAVMVSLAAVWADYGVTPAAVIGHSQGEMAAA
CVAGALSLEDAARIVAVRSDALRQLQGHGDMASLSTGAEQAAELIGDRPGVVVAAVNGPS
STVISGPPEHVAAVVADAEARGLRARVIDVGYASHGPQIDQLHDLLTERLADIRPTNTDV
AFYSTVTAERLTDTTALDTDYWVTNLRQPVRFADTIEALLADGYRLFIEASAHPVLGLGM
EETIEQADMPATVVPTLRRDHGDTTQLTRAAAHAFTAGADVDWRRWFPADPAPRTIDLPT
YAFQRRRYWLADTVKRDSGWDPAGSGHAQLPTAVALADGGVVLNGRVSAERGGWLGGHVV
AGTVLVPGAALVEWVLRAGDEAGCPSLEELTLQAPLVLPESGGLQVQVVVGAADEQGGRR
DVHVYSRSEQDASAVWQCHAVGELGRASVARPVRQAGQWPPAGAEPVEVGGFYEGVAAAG
YEYGPAFRGLRAMWRHGDDLLAEVELPEEAGSPAGFGIHPALLDAALHPLLAQRSRDGAG
AGAHGGQVLLPFSWSGVSLWASEATTVRVRLTGLGGGDDETVSLTVTDPAGGPVVDVAEL
RLRSTSARQVRGSAGPGADGLYELRWTPLPEPLPVPAPANGRDVAADLSGCAVLGELVAE
PGPGIDLEGCPCYPGVGALADNASPPSMILAPVHSDTTGGDGLALTERVLRVIQDFLAAP
SLEQKQTRLAFVTRGAADTGSTTGGSAAPAEAVDPAVAAVWGLVRSAQSENPGRFVLLDT
DAPLDQASVAPLVDAVRSAVEADEPQVALRGGRLLVPRWARAGEPVELAGPAGARAWRLV
GGDSGTLEAVVAEACDDIVLRPLAPGQVRVAVHTAGVNFRDVLIALGMYPDPDALPGTEA
AGVVTEVGPGVTRLSVGDRVMGMMDGAFGPWAVADARMLAPVPPGWGTRQAAAAPAAFLT
AWYGLVELAGLKAGERVLIHAATGGVGMAAVQIARHVGAEVFATASPGKHAVLEEMGIDA
AHRASSRDLAFEDAFRQATDGRGVDVVLNSLTGELLDASLRLLGDGGRFVEMGKSDPRDP
ELVALEHPGVSYEAFDLVADAGPERLGLMLDRLGELFAGGSLVPLPVTAWPLGRAREALR
HMSQARHTGKLVLDVPAPLDPDGTVLVTGGTGTIGAAVAEHLARTGESKHLLIVSRSGPA
AHGAEELVSRIAEFGAEATFVAADVSEPDAVAALIEGIDPAHPLTGVVHAAGVLDNALIG
SQTTESLTRVWAAKAAAAQQLHEATRESRLGLFVMFSSFASTMGTPGQANYSAANAYCDA
LAALRRAEGLAGLSVAWGLWEATSGLTGTLSAADRARIDRYGIRPTSAARGCALLAAARA
HGRPDLLAMDLDARVPAASDAPVPAVLRTLAAAGAPATARPTAAAAADGATDWSGRLAGL
TEEARLELLTELVCTHAAGVLGHADAGAVQVDAPFKELGFDSLTAVELRNRIAAATGLKL
PAALVFDYPQARVLAAHLAERLVPEGAGAMGGVSGAEGVRDAYGAGGPGGDMTAQVLLEV
ARVEHTLSAAVPHGLDRAAVAARLEALLARCTATTAATGAAGAAVEGDGDSDGDGAVDQL
ETATAEQVLDFIDNELGV
selected fasta
>polyketide synthase [monensin polyketide synthase module 2]
ATGGCGAGTGAAGAGCAACTGGTCGAATATCTGCGCAGGGTGACCACCGAGCTCCATGAC
ACGCGTCGGCGCCTGGTGCAGGAGGAGGACCGCAGGCAGGAACCGGTGGCCCTGGTCGGC
ATGGCCTGCCGCTTCCCGGGCGGCGTGGCCTCACCGGAGGACCTCTGGGACCTGGTCGCC
GCGGGCAAGGACGCCATCGAGGACTTTCCCACCGACCGGGGCTGGGACCTGGAGGCGCTC
TACGACCCGGACCCGGCCGCGTACGGGACCAGCTATGTCCGCCACGGCGGGTTCGTGGAC
GACGCGGGCTCCTTCGACGCCGACTTCTTCGGCATCAGCCCGCGAGAAGCCCTGGCGATG
GACCCGCAGCAGCGGCTGATGCTGGAGACGTCCTGGGAGCTGTTCGAGCGCGCCGGCATC
GAACCCGTCTCCCTCAAGGGCAGCCGTACGGGCGTCTACGCCGGGGTGTCCAGCGAGGAC
TACATGTCCCAACTGCCCCGCATCCCCGAGGGGTTCGAGGGGCACGCCACCACCGGCAGC
CTCACCAGCGTCATCTCGGGCCGGGTCGCGTACAACTACGGCCTCGAAGGCCCGGCCGTC
ACCGTCGACACAGCCTGTTCCGCCTCGCTCGTCGCCATCCACCTGGCGAGCCAGGCGCTG
CGCCAGCGTGAGTGCGACCTCGCCCTCGCGGGCGGTGTGCTCGTACTGTCCAGCCCGCTC
ATGTTCACCGAGTTCTGCCGCCAGCGGGGCCTTGCTCCCGACGGCCGCTGCAAGCCGTTC
GCCGCCGCGGCGGACGGCACCGGCTTCTCGGAGGGCATCGGTCTGCTCCTCCTGGAGCGC
CTGTCCGACGCGCGCCGCAACGGCCACAAGGTGCTCGCGGTGATCCGCGGCTCCGCCGTC
AACCAGGACGGCGCGAGCAACGGCCTGACCGCCCCCAACGACGCCGCGCAGGAACAGGTC
ATCCGCGCCGCCCTCGACAACGCCCGCCTCACCCCGTCCGAGGTGGACGCCGTCGAGGCG
CACGGCACCGGCACCAAACTGGGCGACCCCATCGAGGCCGGAGCGCTGCTCGCCACCTAC
GGGCAACACCGCGCCCGGCCCCTCCTCCTCGGCTCCCTCAAGTCCAACATCGGCCACACC
CACGCCACCGCGGGCGTCGCCGGTGTCATCAAGACCGTCATGGCGATCCGCAACGGTCTG
CTCCCCGCCACCCTCCACGTCGAGGAACTGAGCCCGCACGTCGACTGGGACGCGGGCGCG
GTCGAGGTCGTCACGGAGCCCACCCCGTGGCCCGAGACCGGCCACCCCCGGCGCGCGGGC
GTCTCCGCGTTCGGGATCTCCGGGACGAATGCGCACTTGATCCTGGAGGAGGCGCCGCCG
GAGGAGGATGTGCCCGCCCCCGTGGTTGTGGAGTCGGGCGGGGTCGTTCCGTGGGTGGTG
TCCGGGCGGACGCCGGAGGCGCTGCGTGAACAGGCCCGGCGACTCGGCGAGTTCGTGGCA
GGCGACACGGACGCACTGCCGAACGAGGTCGGCTGGTCCTTGGCCACGACCCGGTCGGTG
TTCGAGCACCGGGCTGTGGTCGTGGGGCGTGACCGGGATGCGTTGACGGCTGGCCTGGGG
GCGTTGGCTGCGGGTGAGGCTTCGGCGGGTGTGGTGGCCGGGGTGGCCGGTGATGTGGGT
CCTGGGCCGGTGTTGGTGTTTCCGGGGCAGGGGGCGCAGTGGGTGGGCATGGGTGCCCAG
CTGTTGGACGAGTCTGCGGTGTTCGCGGCGCGGATCGCGGAGTGTGAGCGGGCCCTGTCG
GCGCATGTGGACTGGTCGCTGAGTGCGGTGTTGCGCGGGGACGGGAGTGAGCTGTCCCGG
GTGGAAGTGGTGCAGCCGGTGCTGTGGGCGGTGATGGTCTCGCTGGCTGCGGTGTGGGCG
GATTACGGGGTCACTCCGGCTGCCGTGATCGGGCACTCGCAGGGTGAGATGGCTGCCGCG
TGTGTGGCGGGGGCGCTGTCGCTGGAGGATGCGGCGCGGATCGTAGCGGTACGCAGTGAC
GCGCTTCGTCAGCTGCAAGGGCACGGCGACATGGCCTCGCTCAGCACCGGTGCCGAGCAG
GCCGCTGAGCTGATCGGTGACCGGCCGGGCGTGGTCGTCGCGGCGGTCAATGGGCCGTCG
TCTACGGTGATTTCAGGGCCGCCGGAGCATGTGGCAGCCGTGGTCGCGGATGCGGAGGCA
CGTGGTCTGCGCGCCCGTGTCATCGACGTCGGCTATGCCTCGCATGGCCCCCAGATCGAC
CAGCTCCACGATCTGCTGACCGAACGCCTGGCCGACATCCGGCCCACGAACACGGACGTG
GCCTTCTATTCGACGGTCACCGCCGAGCGCCTGACGGACACCACGGCCCTGGACACGGAT
TACTGGGTCACCAACCTCCGTCAGCCCGTCCGGTTCGCCGACACCATCGAAGCCCTTCTC
GCGGACGGCTACCGCCTGTTCATCGAGGCCAGCGCCCACCCCGTGCTGGGCCTGGGCATG
GAGGAGACCATCGAGCAGGCGGACATGCCCGCCACCGTCGTCCCCACCCTCCGCCGCGAC
CACGGCGACACCACCCAGCTCACCCGCGCCGCCGCCCACGCCTTCACCGCCGGCGCCGAT
GTCGACTGGCGGCGCTGGTTCCCGGCCGACCCCGCCCCCCGCACGATCGATCTCCCCACC
TACGCCTTCCAGCGCCGCCGCTACTGGCTGGCCGACACAGTGAAGCGGGACAGCGGATGG
GACCCGGCCGGGTCGGGGCATGCCCAGTTGCCGACCGCGGTCGCCCTCGCCGACGGGGGA
GTGGTGCTGAACGGCCGGGTGTCCGCCGAGCGCGGTGGCTGGCTGGGCGGGCATGTGGTG
GCGGGGACGGTTCTGGTGCCGGGTGCGGCGTTGGTGGAGTGGGTGTTGCGGGCCGGTGAT
GAGGCGGGTTGCCCCTCGCTTGAGGAGTTGACGCTCCAGGCGCCGTTGGTGTTGCCCGAG
TCGGGTGGGTTGCAGGTTCAGGTGGTCGTGGGTGCGGCTGATGAGCAGGGCGGCCGTCGT
GACGTACATGTGTATTCGAGGTCTGAGCAGGACGCGTCGGCGGTGTGGCAGTGCCATGCC
GTCGGTGAGCTCGGGCGCGCGTCGGTGGCGCGGCCGGTGCGGCAGGCCGGGCAGTGGCCT
CCGGCGGGGGCCGAGCCGGTGGAGGTGGGCGGCTTCTACGAGGGGGTCGCGGCCGCCGGT
TACGAGTACGGTCCGGCGTTCCGTGGGCTGCGCGCGATGTGGCGGCACGGTGATGACCTC
CTTGCGGAGGTCGAGCTGCCGGAGGAGGCCGGTTCGCCGGCCGGTTTCGGCATCCACCCG
GCGCTGCTGGACGCCGCCCTGCACCCGCTGCTCGCACAGCGGAGCCGGGACGGGGCCGGG
GCGGGGGCCCACGGCGGGCAGGTGCTGCTGCCTTTCAGCTGGAGCGGTGTTTCCCTGTGG
GCCAGCGAGGCCACCACTGTGCGGGTGCGGCTCACCGGGCTGGGAGGAGGGGACGACGAG
ACGGTGTCCCTGACGGTAACCGACCCCGCCGGTGGCCCCGTGGTGGACGTGGCAGAGCTG
CGGTTGCGGTCGACGAGCGCCCGGCAGGTGCGGGGTTCGGCAGGCCCCGGCGCGGACGGG
CTCTACGAGCTGCGGTGGACACCGTTGCCCGAGCCGCTTCCCGTACCGGCCCCCGCGAAC
GGTCGCGATGTGGCCGCCGACCTGTCCGGATGCGCGGTGCTCGGCGAACTGGTCGCGGAA
CCGGGCCCGGGCATCGACCTGGAGGGCTGCCCCTGCTACCCGGGCGTCGGCGCGCTCGCC
GACAACGCCTCCCCGCCCTCCATGATCCTCGCCCCCGTGCACAGCGACACCACAGGCGGC
GACGGACTCGCCCTGACGGAACGGGTGTTGCGCGTCATCCAGGACTTCCTGGCTGCACCG
AGTCTGGAACAGAAACAGACGCGCCTGGCCTTCGTGACCCGGGGCGCGGCGGACACAGGT
AGCACGACGGGAGGCTCGGCTGCCCCGGCAGAGGCAGTCGACCCGGCGGTCGCGGCCGTA
TGGGGCCTAGTACGCAGCGCGCAGTCGGAGAACCCCGGCCGCTTCGTACTGCTGGACACC
GACGCGCCCCTCGACCAGGCGTCCGTTGCCCCTCTCGTGGACGCGGTGCGGTCTGCCGTG
GAGGCGGACGAGCCCCAAGTCGCCCTGCGCGGGGGACGGTTGCTCGTGCCCAGGTGGGCG
CGGGCCGGCGAGCCCGTCGAGCTGGCCGGGCCGGCCGGAGCGCGGGCGTGGCGGCTGGTG
GGCGGAGACTCCGGGACGCTGGAGGCCGTCGTGGCGGAGGCTTGCGACGACATTGTGCTG
CGCCCGTTGGCGCCGGGCCAGGTCCGCGTCGCCGTCCATACGGCCGGGGTCAATTTCCGT
GACGTCCTGATCGCCCTGGGCATGTACCCGGACCCGGACGCGCTGCCCGGCACCGAGGCG
GCCGGCGTGGTGACGGAGGTCGGGCCGGGCGTCACCCGTCTGTCGGTGGGCGACCGCGTG
ATGGGCATGATGGACGGCGCCTTCGGCCCGTGGGCCGTCGCCGACGCGCGCATGCTGGCC
CCGGTCCCGCCCGGCTGGGGCACCCGGCAGGCGGCCGCCGCTCCCGCCGCGTTCCTGACG
GCTTGGTACGGGCTGGTGGAGCTGGCCGGTCTGAAGGCGGGCGAGCGTGTGTTGATCCAT
GCCGCCACGGGTGGTGTGGGGATGGCGGCGGTGCAGATCGCCCGGCATGTGGGTGCCGAG
GTGTTCGCCACCGCGAGTCCGGGCAAGCACGCCGTGCTGGAGGAGATGGGCATCGACGCC
GCCCACCGCGCCTCGTCGCGCGACCTCGCCTTCGAGGACGCCTTCCGGCAGGCCACCGAC
GGCCGTGGCGTGGACGTCGTCCTCAACAGCCTCACCGGTGAACTGCTCGACGCGTCCCTG
CGATTGCTCGGCGACGGCGGGCGCTTCGTGGAGATGGGCAAGAGCGATCCGCGCGACCCC
GAGCTGGTCGCGCTGGAGCACCCCGGGGTGTCGTACGAGGCCTTCGACCTCGTCGCCGAC
GCCGGGCCCGAGCGGCTCGGGCTGATGCTCGACAGGCTCGGCGAGCTCTTCGCCGGCGGA
TCACTGGTACCGCTGCCGGTCACCGCATGGCCGCTGGGGCGGGCGCGAGAGGCGCTCCGC
CACATGAGTCAGGCGAGGCACACCGGCAAGCTGGTGCTCGACGTGCCCGCGCCGCTCGAC
CCCGACGGCACCGTCCTCGTCACCGGGGGTACCGGCACCATCGGCGCCGCCGTGGCCGAA
CACCTGGCGCGTACCGGGGAGAGCAAGCACCTGCTCATCGTCAGCCGCAGCGGGCCGGCC
GCCCACGGCGCCGAGGAACTTGTCTCTCGTATAGCCGAGTTCGGGGCCGAAGCCACCTTC
GTCGCTGCCGACGTGAGTGAGCCCGACGCGGTCGCCGCCCTGATCGAAGGGATCGATCCG
GCCCATCCGCTGACCGGTGTCGTGCATGCCGCCGGAGTACTCGACAACGCTCTGATCGGC
TCCCAGACCACCGAAAGCCTCACCCGCGTATGGGCGGCGAAGGCCGCCGCCGCGCAGCAA
CTCCACGAGGCCACGAGGGAGTCGAGGCTGGGACTGTTCGTGATGTTCTCCTCCTTCGCC
TCCACCATGGGCACCCCAGGGCAGGCCAACTACTCCGCCGCCAACGCCTATTGCGACGCG
CTGGCCGCTCTCCGACGCGCGGAGGGGCTCGCCGGCCTGTCCGTGGCGTGGGGGTTGTGG
GAGGCCACCAGCGGCCTGACCGGGACGTTGTCGGCGGCCGACCGGGCCCGCATCGACCGG
TACGGCATCAGGCCGACCAGCGCGGCACGCGGCTGCGCCCTGCTGGCAGCGGCACGCGCC
CACGGGCGCCCCGACCTGCTCGCCATGGACCTGGACGCCCGCGTACCCGCCGCGTCCGAC
GCTCCGGTCCCCGCCGTGCTGCGCACTCTGGCGGCCGCCGGAGCGCCCGCCACCGCCCGT
CCCACCGCGGCGGCGGCCGCTGACGGGGCGACGGACTGGTCCGGCAGGCTCGCCGGCCTC
ACCGAGGAGGCACGGCTCGAACTCCTCACCGAGTTGGTGTGCACCCACGCGGCAGGGGTG
CTCGGGCACGCCGACGCGGGCGCGGTCCAGGTGGACGCGCCGTTCAAGGAACTCGGCTTC
GACTCGCTGACCGCCGTCGAACTGCGCAACCGGATCGCCGCCGCGACCGGCCTGAAACTG
CCCGCCGCCCTCGTCTTCGACTACCCGCAGGCTCGCGTTCTCGCCGCCCACCTGGCCGAA
CGGCTCGTCCCGGAGGGCGCGGGGGCCATGGGCGGTGTGAGCGGTGCGGAGGGCGTGAGG
GACGCGTACGGGGCAGGCGGTCCGGGCGGCGACATGACCGCCCAGGTCTTGCTGGAGGTG
GCCCGCGTCGAGCACACCCTGTCCGCCGCCGTCCCGCACGGCCTGGACCGGGCGGCCGTC
GCGGCCCGCCTGGAGGCGCTGCTCGCCCGCTGCACGGCGACGACGGCGGCCACGGGGGCC
GCGGGAGCCGCGGTGGAGGGTGACGGCGACAGCGACGGCGACGGCGCCGTGGATCAGCTG
GAGACGGCCACCGCCGAGCAAGTACTGGACTTCATCGACAACGAACTCGGGGTGTGA
[2] KS34..408
[2] AT564..881
[2] methylmalonyl-CoA752..756
[2] DH927..1090
[2] ER1445..1753
[2] KR1763..1943
[2] ACP2049..2119
[2] KS100..1224
[2] AT1690..2643
[2] methylmalonyl-CoA2254..2268
[2] DH2779..3270
[2] ER4333..5259
[2] KR5287..5829
[2] ACP6145..6357

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [561-685]  5.30000000000001e-70 G3DSA:3.40.366.10 [752-870]  5.30000000000001e-70 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1763-1930]  5.89999999999994e-54 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [2077-2092]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2049-2119]  PS50075
PS50075   ACP_DOMAIN
 [2049-2122]  2.8e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [2040-2126]  3.30000526807186e-22 SSF47336
SSF47336   ACP_like
 [2052-2118]  2.5e-11 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [1447-1592]  1.70000295590053e-34 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1585-1679]  3.09999999999998e-20 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1465-1522]  1.4e-09 PF08240
PF08240   ADH_N
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  3.60000000000002e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-408]  3.89999999999997e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [564-881]  3.70000000000004e-104 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-25]  5.40000000000001e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [562-864]  4.39999001237725e-61 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [687-751]  1.20000117458134e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-296]  4.59999999999996e-89 G3DSA:3.40.47.10 [297-461]  3.79999999999991e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-406]  6.4999795054176e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1537-1726]  2.50000000000001e-52 G3DSA:3.40.50.720 [1763-1947]  1.80000000000002e-36 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [566-861]  1.3000049540733e-111 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2050-2122]  4.50001022902825e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [927-1090]  5.10003242202156e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-460]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1763-1943]  3.10001307370206e-48 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1445-1753]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit