close all open/close all

CDS information : Monen_00170


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction29,974 / 42,372 / + [in whole cluster]
29,974 / 42,372 / + [in contig]
Location29974..42372 [in whole cluster]
29974..42372 [in contig]
TypeCDS
Length12,399 bp (4,132 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)monensin polyketide synthase modules 3 and 4
Gene
Gene (GenBank)monAIII
EC number
Keyword
Note
Note (GenBank)
  • MonAIII
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionPKS/NRPS Module

3 malonyl-CoA
4 methylmalonyl-CoA
KS34..405
AT609..932
DH981..1198
KR1576..1756
ACP1873..1943
KS1975..2351
AT2507..2824
DH2873..3037
ER3364..3671
KR3681..3861
ACP3971..4041

close this sectionSequence

selected fasta
>polyketide synthase [monensin polyketide synthase modules 3 and 4]
MVSEEKLVDYLKRVSADLHATRQRLREAEERGQEPVAVVEAACRYPGGIRTPEDLWDLVA
AGGNALGAFPDNRGWDLRRLFHPDPDHPGTTYAREGGFLHDADLFDPEFFGISPREAAVL
DPQQRLLLECAWEALERAGIDPRSLQGSRTGVYAGAALPGFGTPHIDPAAEGHLVTGSAP
SVLSGRLAYTFGLEGPAVTIDTACSSSLVAVHLAAHALRQRECDLALAGGVTVMTTPYVF
TEFSRQRGLAADGRCKPFAAAADGTAFSEGAGLLVLERLSDARRAGHRVLAVIRGSAVNQ
DGASNGLTAPNGPAQQRVIRAALAGARLSPAEVDAVEAHGTGTRLGDPIEADALLATYGQ
ERHGGRPLWLGSVKSNIGHTQGAAGAAGLIKMVQALRHETLPATLYADEPTPHADWESGA
VRLLSAPVAWPRGEHGEHTRRAGISSFGISGTNAHLILEEAPAADAEGAGGDGDGDGGGV
RPVVRVGATGPREEQGQGQGQEQHQQQRQQRQRSSMMPTPHLPWLLSARSPAALRAQADA
LANHVAHADHSIADIGGTLLRRTLFEHRAVVLGTDRDERAAALAALAAGRAHPALTRAAG
PARNGGTAFLFTGQGSQRPGMGRQLYDTFDVFAESLDETCARLDPLLEQPLKPVLFAPAD
TAQAAVLHGTGMTQAALFALEVALYRQVTSFGIAPSHLTGHSVGEIAAAHVAGVFSLADA
CTLVAARGRLMQALPAGGAMLAVQAAEDDVLPLLAGQEERLSLAAVNGPTAVVVSGEAAA
VGEVEKALRGRGLKTKRLNVSHAFHSPLIEPMLDDFREVARGLTFHAPTLPVVSNLTGRL
ADAELMADAEYWVRHVRRPVRFHDGLRALSEQGVVRYLELGPDPVLATMVQDGLPAPAEG
EEPEPVVAAALRSKHDEGRTLLGAVAALHTDGQPADLTALFPADAGQVPLPTYRFQRRRY
WRVAPDAAAPARAAGLQETGHPLLPAVIRQADGGILLAGRLSLRTHPWLADHTIAGGVPL
PATAFVELALLAGRHAACDTIDDLTLETPLLLDDTGTGVGAAVGAGADALVDAIEVQLAL
GAPDGSGRRALTVHSRPADDAADDGDAADAADAAGRGGPGGSGDLGDPGDPGDLGDGGGS
RGWRRHATGILSAGPAAEPAAPDAAPWPPADATALDVDALYARLDAQGYSYGPAFRAVHA
AWRHGDDLYADVRLADEQRAEADAFALHPALLDAALHAVDELYRGSEGRGQEQGQGGQEP
EQGRGDADAPVRLPFSFSDIRHHATGATRLWVRLSPQGDDRLRLSLTDGEGGQVATVDAL
QLRLIPADRWRAARPTTAAPLYHLDWHELPLPEPAETDPAAHSWAVLGAHDAGLAPAAHY
PDLAALKAAVEAGEPVPDIVFAPFPAQGTETDVPAQVRAHARHALELLRDWLTTEAFAAA
RLVVLTTGAVTARPEDGPADLATAPVWGLVRAAQAEQPDHVVLVDIDKDIDKDTDEETDQ
ATDAGTASRHALPAALAAAAAQAETQLALRAGTVLVPRLAVVPPRTDTPALHATAPESTT
DTVDSTGIAGAAESGGTVLITGGTGGLGQAVARHLAAAHGARHLLLVSRRGDAAEGVAEL
RADLADDGVDVRVAACDITDRDALAGLLADIPAAHPLTAVVHTAGVIDDSLITAMTPERL
DAVLAPKADAAWHLHELTRDKDLSAFVLFSSGASVLGNGGQANYAAANTFLNTLAEHRRA
AGLAATSVAWGLWESASGGMAARLGDADRARIHRTGVTGLTDEQALALFDAALTAEHPTV
LATRFDRAVLRGQAAARTLQPALRGLVRTPRPTASAGAIGSTAATGSATDENAPSSWAAR
LARLSAADRDRALNELIREQIATVLAHPSPDTIELGRAFQELGFDSLTALELRNRLSTAT
GIRLPATLVFDHPSPTALVRHLHSHLPDEAQHTSPTAPGASAEGTAATATGIDDDPIAIV
GMACRYPGGVTSPEQLWQLVATGTDAIGPFPEDRGWDTAGLFDPDPDQVGHSYTREGGFL
YDAARFDAGFFGISPREAAATDPQQRLLLETAWQAFEHAGIDPAALRGTPCGVITGIMYD
DYGSRFLARKPDGFEGRIMTGSTPSVASGRVAYTFGLEGPAITVDTACSSSLVAMHLAAQ
ALRQGECELALAGGVTVMATPNTFVEFSRQRGLAPDGRCKPFAAAADGTGWGEGAGLVVL
ERLSDARRKGHRVLALLRGSAVNQDGASNGMTAPNGPSQERVIRTALAGAGRGPEDIDVV
EAHGTGTTLGDPIEAQALLATYGQGRPEDRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAL
RHEQLPTTLHADEPTPHVQWDGGGVRLLTEPVPWSRGERTRRAGVSSFGISGTNAHLILE
EPPEEDLPEPVAAEPGGVVPWVVSGRTPDALREQARRLGEFVVGAGDVSAAEVGWSLATT
RSVFEHRAVVAGRDRDDLVAGMQALAAGETPTDVVSGAAASSGAGPVLVFPGQGSQWVGM
GAQLLDESPVFAARIAECEQALSAYVDWSLSDVLRGDGSELSRVEVVQPVLWAVMVSLAA
VWADYGVTPAAVVGHSQGEMAAACVAGALSLEDAARIVAVRSDALRQLQGHGDMASLGTG
AEQAAELIGDRPGVVVAAVNGPSSTVISGPPEHVAAVVAEAEARGLRARVIDVGYASHGP
QIDQLHDLLTEGLADIRPANTDVAFYSTVTAERLTDTTALDTDYWVTNLRQPVRFADTIE
ALLADGYRLFIEASAHPVLGLGMEETIEQADIPATVVPTLRRDHGDTTQLTRAAAHAFTA
GADVDWRRWFPADPTPRTVDLPTYAFQHQHYWLEEPSGLTGDAADLGMVAAGHPLLGACV
ELAESDSYLFTGRLSRRAPSWLAEHVVAGTVLVPGAALVEWVLRAGDEAGCPTIEELTLQ
APLVLPESGGLQVQVVVGATDEQSGRRDVHVYSRSEQDASAVWVCHAVGVVSSEMPEAAA
ELSGQWPPAGAEAVDVEDFYARAAEAGYAYGPAFQGLRALWRHGTELFAEVVLPEQAGGH
DGFGIHPALLDAALHPLMLLDRPADGQMWLPFAWSGVSLNADRATHVRVRLSPRGEAAER
DLRVVIADATGAPVLTVDALTLRAADPGRLGAAARGGVDGLYTVDWTPLPLPQPLPLPRT
DAGGSADWVILSDNSSAALADAVSSATAAGGGAPWALLAPVGGGSADDGLPVVRRTLSLV
QEFLAAPELTESRLVIVTRGAVATDADGDVAASAAAVWGLIRSAQSENPGRFVLLDVEEE
HLHPDGGELPYAALRHAVEELDEPQLALRSGKFLVPRMTPAAAPEELVPPVGTSGWRLGT
SGTATLENLSVIDAPEAFAPLEPGQVRISVRAAGMNFRDVLIALGMYPDKGTFAGSEGAG
HVTEVGPGVTHLSVGDRVMGLFEGAFAPLAVADARMVVPIPEGWSFQEAAAVPVVFLTAW
YGLVDLGRLRAGESLLIHAGTGGVGMAATQIARHLGAEVFATASPAKHGVLDGMGIDAAH
RASSRDLDFEETLRAATGGRGMDVVLNSLAGEFTDASLRLLAEGGRMVDMGKTDKRDPDR
VAAEHAGAWYRAFDLVPHAGPDRIGEMLAELGELFASGALAPLPVQTWPLGRAREAFRFM
SQAKHTGKLVLEIPPALDPDGTVLITGGTGVLAAAVAEHLVREWGVRHLLLAGRRGSEAP
GSSELAEELTELGAEVTFAAADVSDPDAVAELVGKTDPAHPLTGVIHAAGVLDDAVVTAQ
TPESLARVWAAKATAAHLLHEATREARLGLFLVFSSAAATLGSPGQANYAAANAYCDALV
RQRRAEGLAGLSIGWGLWQTASGMTGHLGETDLARMKRTGFTPLTTEGGLALLDAARAHG
RPHVVAVDLDARAVAAQPAPSRPALLRALAAGATPGARTARRTAAAGSVAPAGGLADRLA
GLPHPERRRLLLDLVRGNVAGVLGHSDHDAVRPDTSFKELGFDSLTAVELRNRLAAATGL
KLPAALVFDYPESATLVDHLLERLSPDGAPPPVKDAADPVLNDLGRIESSLDALALDADA
RSRVTRRLNTLLSKLNGAATAGSPADVTDLDALDALDDVSDDEMFEFIDREL
selected fasta
>polyketide synthase [monensin polyketide synthase modules 3 and 4]
ATGGTGAGCGAAGAGAAACTGGTCGACTACCTCAAGCGTGTCTCCGCGGACCTGCACGCC
ACCCGGCAGCGGCTGCGCGAGGCGGAGGAGCGCGGCCAGGAACCCGTGGCCGTGGTGGAG
GCCGCCTGCCGCTACCCCGGCGGCATCCGCACCCCCGAAGACCTGTGGGACCTGGTCGCC
GCGGGCGGCAACGCCCTGGGCGCCTTCCCCGACAACCGCGGCTGGGACCTGCGACGCCTC
TTCCACCCCGACCCCGACCACCCCGGGACGACCTACGCCCGCGAGGGCGGCTTCCTCCAC
GACGCCGACCTGTTCGACCCGGAGTTCTTCGGCATCAGCCCCCGCGAGGCCGCGGTCCTC
GACCCGCAGCAGCGACTGCTCCTGGAGTGCGCCTGGGAGGCACTGGAGCGCGCGGGCATC
GACCCGCGGTCCCTCCAGGGCAGCCGTACCGGCGTGTACGCGGGTGCCGCCCTGCCCGGC
TTCGGCACCCCGCACATCGACCCCGCCGCCGAGGGCCACCTGGTCACCGGCAGCGCCCCG
AGCGTCCTCTCGGGCCGGCTCGCCTACACCTTCGGCCTCGAAGGGCCCGCGGTGACGATC
GACACCGCCTGCTCGTCGTCGCTCGTCGCCGTGCACCTGGCGGCCCACGCGCTGCGGCAG
CGCGAGTGCGATCTGGCGCTCGCGGGCGGTGTCACCGTCATGACCACCCCGTACGTGTTC
ACCGAGTTCTCGCGCCAGCGCGGCCTGGCCGCCGACGGCCGGTGCAAGCCCTTCGCGGCC
GCCGCGGACGGCACGGCCTTCTCCGAGGGCGCCGGACTCCTCGTACTGGAACGCCTCTCC
GACGCCCGCCGGGCCGGCCACCGGGTGCTCGCCGTCATCCGCGGCTCGGCCGTCAACCAG
GATGGCGCGAGCAACGGCCTCACCGCCCCCAACGGCCCCGCCCAGCAGCGCGTGATCCGC
GCCGCCCTCGCCGGGGCGCGGCTCTCGCCCGCGGAGGTGGACGCGGTCGAGGCGCACGGC
ACCGGCACCCGGCTGGGCGACCCCATCGAGGCCGACGCGCTCCTCGCCACCTACGGTCAG
GAGCGCCACGGGGGCCGGCCGCTGTGGCTCGGCTCGGTGAAATCCAACATCGGCCACACG
CAGGGCGCGGCCGGTGCCGCGGGCCTGATCAAGATGGTCCAGGCACTGCGGCACGAGACG
CTGCCCGCCACGTTGTACGCCGACGAGCCCACCCCGCACGCCGACTGGGAGTCGGGCGCG
GTGCGCCTGCTCAGCGCGCCGGTCGCCTGGCCGCGCGGGGAGCACGGGGAGCACACCCGC
AGGGCCGGCATCTCCTCCTTCGGCATCTCCGGCACGAACGCCCACCTCATCCTGGAGGAG
GCGCCCGCGGCCGACGCCGAAGGAGCGGGTGGCGACGGCGATGGCGACGGGGGAGGGGTG
CGGCCGGTGGTGCGGGTCGGCGCCACGGGCCCCCGCGAAGAGCAGGGCCAAGGACAGGGC
CAAGAGCAGCACCAACAGCAACGTCAGCAGCGGCAGCGGTCGTCGATGATGCCGACGCCG
CACCTCCCGTGGCTGCTGTCCGCCCGCAGCCCCGCCGCGCTCCGCGCCCAGGCCGACGCG
CTGGCGAACCATGTCGCCCACGCGGACCACTCCATCGCCGACATCGGCGGCACACTGCTG
CGCCGCACCCTGTTCGAGCACCGGGCGGTCGTCCTCGGAACCGACCGTGATGAGCGTGCC
GCAGCGCTTGCCGCCCTCGCGGCAGGACGCGCACACCCCGCGCTGACCCGGGCCGCAGGG
CCGGCGAGGAACGGCGGCACCGCCTTCCTGTTCACCGGCCAGGGAAGCCAACGCCCAGGC
ATGGGCAGGCAGTTGTACGACACCTTCGACGTCTTCGCCGAGTCGCTCGACGAGACCTGC
GCCCGGCTCGACCCCCTGCTCGAACAGCCGCTGAAGCCCGTCCTGTTCGCCCCCGCCGAC
ACCGCGCAGGCCGCCGTGCTGCACGGGACCGGCATGACGCAGGCCGCGCTGTTCGCCCTC
GAAGTCGCCCTGTACCGCCAGGTCACCTCCTTCGGGATCGCCCCCAGCCACCTGACCGGG
CACTCCGTCGGCGAGATCGCCGCCGCCCACGTCGCCGGGGTGTTCTCCCTGGCGGACGCC
TGCACGCTGGTCGCGGCCCGGGGCCGCCTCATGCAGGCCCTGCCCGCAGGTGGCGCCATG
CTCGCCGTCCAGGCGGCCGAGGACGACGTACTGCCGCTGCTCGCCGGGCAGGAGGAACGT
CTCTCCCTCGCCGCCGTCAACGGCCCCACCGCCGTCGTCGTGTCCGGTGAGGCCGCTGCC
GTCGGGGAGGTGGAGAAGGCGCTGCGCGGGCGCGGACTGAAGACCAAGCGGCTCAACGTC
AGTCACGCCTTCCACTCGCCGCTCATCGAGCCGATGCTCGACGACTTCCGCGAAGTGGCC
CGCGGGCTGACCTTCCACGCGCCGACGCTGCCCGTCGTCTCCAACCTCACCGGCCGCCTC
GCCGACGCGGAGCTGATGGCCGACGCCGAGTACTGGGTGCGGCACGTACGCCGGCCGGTG
CGGTTCCACGACGGGCTGCGCGCTCTCAGCGAGCAAGGCGTCGTGCGCTACCTGGAGTTG
GGGCCCGACCCGGTCCTCGCCACCATGGTCCAGGACGGTCTCCCGGCCCCGGCGGAGGGA
GAGGAGCCCGAGCCGGTCGTCGCCGCGGCGCTGCGCTCCAAGCACGACGAGGGACGCACC
CTGCTGGGTGCCGTCGCCGCGCTCCACACCGACGGACAGCCGGCCGACCTCACCGCCCTC
TTCCCCGCCGACGCCGGGCAAGTGCCGCTCCCCACCTACCGGTTCCAGCGGCGACGGTAC
TGGCGCGTCGCGCCCGACGCCGCCGCGCCGGCCCGCGCCGCCGGCCTCCAGGAGACCGGC
CACCCGCTGCTGCCCGCCGTCATCCGGCAGGCCGACGGCGGCATCCTGCTCGCGGGACGC
CTGTCCCTGCGTACGCATCCATGGCTCGCCGACCACACCATCGCGGGCGGCGTCCCGCTG
CCCGCCACCGCCTTCGTCGAACTCGCCCTGCTCGCAGGGCGGCACGCCGCCTGCGACACG
ATCGACGATCTGACGCTGGAGACGCCGCTGCTGCTCGACGACACCGGTACCGGTGTCGGG
GCGGCTGTGGGCGCGGGCGCCGATGCCCTCGTCGATGCCATAGAAGTGCAGCTTGCCCTC
GGCGCTCCCGACGGTTCCGGCCGCCGTGCTCTCACCGTCCACTCCCGTCCTGCCGACGAT
GCGGCTGACGACGGCGACGCGGCCGACGCGGCCGATGCGGCAGGCCGGGGAGGCCCGGGC
GGCTCGGGTGACCTGGGCGATCCTGGCGATCCGGGCGATCTGGGCGACGGCGGGGGCTCC
CGCGGCTGGCGCCGTCACGCCACCGGCATCCTCAGCGCCGGCCCGGCCGCCGAACCGGCC
GCCCCCGACGCCGCTCCCTGGCCGCCCGCCGACGCCACCGCCCTCGACGTCGACGCGCTG
TACGCCCGGCTCGACGCGCAGGGCTACAGCTACGGGCCCGCCTTCCGGGCCGTCCACGCC
GCCTGGCGGCACGGCGACGACCTCTACGCCGATGTCCGCCTCGCCGACGAACAGCGCGCT
GAAGCCGACGCGTTCGCCCTCCACCCGGCCCTGCTCGACGCCGCCCTGCATGCCGTCGAC
GAGCTGTACCGCGGCAGTGAGGGGCGGGGGCAGGAGCAGGGGCAGGGTGGTCAGGAGCCG
GAGCAGGGCCGTGGCGACGCGGACGCCCCGGTACGGCTGCCGTTCTCCTTCAGCGACATA
CGCCACCACGCCACCGGGGCCACACGGCTGTGGGTCCGCCTCAGCCCCCAGGGCGACGAT
CGGCTGCGGCTGTCCCTGACCGACGGCGAGGGCGGGCAGGTCGCGACAGTCGACGCCCTC
CAACTGCGGTTGATCCCCGCCGACCGGTGGCGCGCGGCCCGCCCCACCACAGCCGCCCCC
CTGTACCACCTGGACTGGCACGAGCTGCCGTTGCCCGAGCCGGCCGAGACGGACCCGGCC
GCCCACTCCTGGGCTGTGCTCGGAGCGCACGACGCGGGCCTCGCTCCCGCCGCGCACTAC
CCGGACCTGGCGGCCCTGAAAGCCGCCGTCGAGGCCGGCGAGCCCGTGCCGGACATCGTC
TTCGCACCGTTCCCCGCGCAGGGGACGGAGACCGATGTCCCGGCTCAGGTACGAGCCCAC
GCCCGGCACGCCCTGGAGCTGCTGCGCGACTGGCTCACCACGGAAGCTTTCGCCGCCGCC
CGCCTCGTCGTCCTCACGACCGGTGCGGTCACCGCCCGCCCAGAGGACGGGCCCGCCGAC
CTGGCCACCGCACCTGTATGGGGCCTGGTCCGAGCCGCCCAGGCCGAACAACCCGACCAT
GTCGTCCTGGTGGACATCGACAAGGACATCGATAAGGACACCGACGAGGAGACCGACCAG
GCCACCGACGCGGGCACCGCATCGCGCCACGCTCTGCCCGCCGCCTTGGCCGCGGCGGCC
GCCCAAGCCGAGACACAGCTCGCCCTGCGCGCGGGCACCGTGCTCGTGCCGCGCCTCGCC
GTCGTCCCGCCCCGGACCGACACCCCAGCGCTGCACGCCACCGCCCCGGAGAGCACCACG
GACACTGTGGACTCCACGGGCATCGCGGGCGCTGCGGAATCCGGCGGCACCGTCCTGATC
ACCGGCGGAACCGGCGGCCTCGGGCAGGCCGTCGCCCGTCACCTCGCCGCCGCGCATGGC
GCCCGCCACCTGCTCCTCGTCAGCCGCAGGGGCGACGCCGCCGAGGGCGTCGCCGAGTTG
CGCGCCGACCTCGCGGACGACGGCGTCGACGTACGCGTCGCCGCCTGCGACATCACCGAC
CGCGACGCGCTGGCCGGGCTCCTCGCGGACATCCCCGCCGCGCACCCGCTCACCGCGGTC
GTGCACACCGCGGGCGTCATCGACGACAGCCTCATCACGGCGATGACCCCCGAGCGGCTC
GACGCCGTCCTCGCACCCAAGGCCGACGCGGCCTGGCACCTGCACGAACTCACCCGCGAC
AAGGACCTGTCGGCCTTCGTCCTCTTCTCCTCGGGCGCCTCCGTCCTCGGCAACGGCGGC
CAGGCCAACTACGCGGCCGCCAACACCTTCCTCAACACCCTCGCCGAACACCGCCGCGCG
GCCGGCCTCGCCGCCACCTCCGTGGCCTGGGGCCTGTGGGAGTCCGCGTCCGGCGGCATG
GCCGCCCGGCTCGGCGACGCCGACCGCGCCCGCATCCACCGCACCGGCGTGACGGGCCTG
ACCGACGAGCAGGCCCTGGCCCTCTTCGACGCGGCCCTGACCGCCGAGCACCCCACGGTC
CTCGCCACCCGCTTCGACCGCGCCGTGCTGCGCGGCCAGGCCGCCGCCCGCACCCTGCAG
CCCGCCCTGCGCGGCCTGGTACGCACTCCGCGCCCCACCGCGTCCGCCGGGGCCATCGGG
TCCACCGCAGCCACCGGGTCCGCCACGGACGAGAACGCGCCCTCCTCGTGGGCCGCCCGG
CTCGCCCGGCTGTCCGCCGCCGACCGCGACCGCGCCCTCAACGAACTCATTCGCGAGCAG
ATCGCGACCGTCCTGGCACACCCCTCACCCGACACCATCGAACTGGGCCGCGCCTTCCAG
GAGTTGGGCTTCGACTCGCTCACCGCCCTGGAACTCCGCAACCGCCTCTCCACGGCCACC
GGCATCCGGCTGCCCGCCACCCTCGTCTTCGACCACCCGAGCCCCACCGCCCTCGTACGC
CATCTCCACAGCCATCTCCCCGACGAGGCCCAGCACACGTCCCCGACCGCCCCCGGCGCC
TCTGCGGAGGGCACCGCCGCCACGGCCACCGGCATCGACGACGACCCGATCGCCATCGTC
GGCATGGCGTGCCGCTACCCGGGCGGCGTGACCTCGCCCGAGCAGCTGTGGCAGCTCGTG
GCCACCGGCACCGACGCCATCGGCCCGTTCCCCGAGGACCGCGGCTGGGACACGGCCGGA
CTGTTCGATCCCGACCCCGACCAGGTCGGCCACAGCTACACCCGCGAAGGCGGCTTCCTC
TACGACGCCGCCCGCTTCGACGCGGGCTTCTTCGGCATCAGCCCGCGCGAGGCCGCCGCC
ACCGACCCGCAGCAGCGCCTGCTCCTGGAAACCGCCTGGCAGGCGTTCGAACACGCGGGC
ATCGACCCCGCCGCCCTGCGCGGCACCCCGTGCGGCGTCATCACCGGAATCATGTACGAC
GACTACGGATCCCGCTTCCTCGCGCGCAAACCGGACGGCTTCGAGGGCCGCATCATGACC
GGCAGCACGCCGAGCGTGGCCTCCGGCCGGGTCGCGTACACCTTCGGCCTGGAGGGCCCC
GCCATCACGGTGGACACCGCGTGCTCCTCCTCGCTGGTCGCGATGCACCTGGCGGCGCAG
GCGCTGCGGCAGGGCGAGTGCGAACTGGCCCTGGCCGGGGGTGTGACCGTGATGGCCACC
CCGAACACCTTCGTGGAGTTCTCCCGCCAGCGCGGCCTGGCCCCCGACGGCCGCTGCAAG
CCGTTCGCCGCCGCGGCGGACGGCACCGGCTGGGGCGAGGGCGCCGGACTCGTCGTCCTG
GAGCGCCTCTCCGACGCGCGCCGCAAGGGACACCGCGTCCTCGCCCTGCTGCGCGGTTCG
GCCGTGAACCAGGACGGCGCGAGCAACGGCATGACCGCCCCGAACGGTCCCTCGCAGGAA
CGGGTCATCCGCACCGCCCTGGCCGGCGCGGGCCGTGGTCCCGAGGACATCGACGTGGTG
GAGGCGCACGGCACCGGCACCACGCTCGGCGACCCGATCGAGGCGCAGGCCCTGCTCGCC
ACGTACGGGCAGGGGCGCCCGGAGGACCGCCCGCTCTGGCTCGGCTCGGTGAAGTCGAAC
ATCGGCCACACGCAGGCCGCCGCCGGTGTCGCGGGCGTCATCAAGATGGTCATGGCACTG
CGCCACGAGCAACTGCCCACGACCCTGCACGCCGACGAGCCGACCCCCCACGTGCAATGG
GACGGCGGCGGCGTACGTCTCCTGACCGAACCGGTCCCGTGGTCGCGCGGCGAGCGCACG
CGGCGCGCCGGGGTGTCGTCCTTCGGGATCTCCGGGACGAACGCGCACCTGATCCTGGAG
GAGCCGCCGGAGGAGGACCTGCCCGAGCCCGTGGCGGCGGAGCCGGGTGGGGTGGTGCCG
TGGGTGGTGTCCGGGCGGACGCCGGACGCGTTGCGTGAACAGGCGCGGCGGCTCGGCGAG
TTTGTCGTCGGTGCCGGGGATGTGTCGGCAGCCGAGGTGGGATGGTCACTGGCCACGACG
CGGTCGGTGTTCGAGCACCGGGCCGTGGTGGCGGGCCGGGACCGGGACGATCTGGTTGCC
GGGATGCAGGCGCTGGCGGCAGGGGAGACGCCGACAGATGTCGTGTCCGGTGCGGCGGCT
TCCTCCGGTGCGGGGCCGGTGTTGGTGTTCCCGGGGCAGGGGTCGCAGTGGGTGGGCATG
GGTGCCCAGCTCCTTGACGAGTCCCCCGTCTTCGCGGCGCGGATCGCGGAGTGTGAGCAG
GCGCTGTCGGCGTACGTGGACTGGTCGCTGAGTGATGTCCTGCGCGGGGACGGGAGTGAG
CTGTCCCGGGTCGAGGTCGTGCAGCCCGTGTTGTGGGCGGTAATGGTCTCGCTGGCTGCC
GTCTGGGCGGATTACGGGGTCACTCCGGCCGCTGTGGTGGGGCATTCGCAGGGTGAGATG
GCTGCCGCGTGTGTGGCGGGGGCGCTGTCGCTGGAGGATGCGGCGCGGATTGTGGCGGTA
CGCAGTGACGCGCTTCGTCAGCTGCAAGGGCACGGCGACATGGCCTCACTCGGCACTGGT
GCCGAGCAGGCCGCTGAGCTGATCGGTGATCGGCCGGGAGTGGTCGTCGCGGCAGTCAAC
GGGCCGTCGTCTACCGTGATTTCGGGGCCGCCGGAGCATGTGGCCGCTGTGGTCGCGGAG
GCGGAGGCACGTGGTCTGCGCGCCCGTGTGATCGACGTCGGGTATGCCTCGCACGGCCCC
CAGATCGACCAGCTCCACGACCTCCTCACCGAGGGCCTGGCTGACATCCGGCCCGCGAAC
ACGGACGTGGCCTTCTATTCGACGGTCACCGCCGAGCGCCTGACGGACACCACAGCCCTG
GATACGGATTACTGGGTGACCAACCTCCGCCAGCCGGTCCGGTTCGCCGACACCATCGAA
GCGCTTCTCGCGGACGGCTATCGCCTGTTCATCGAGGCCAGCGCGCACCCGGTGTTGGGC
CTGGGCATGGAGGAGACCATCGAGCAGGCGGACATCCCTGCCACGGTCGTCCCCACCCTG
CGCCGCGACCACGGCGACACCACCCAGCTCACCCGCGCCGCCGCCCACGCCTTCACCGCC
GGCGCCGATGTCGACTGGCGACGCTGGTTCCCGGCCGACCCCACCCCCCGTACCGTCGAC
CTCCCCACCTACGCCTTCCAGCACCAGCACTACTGGCTGGAGGAGCCCAGTGGGCTCACC
GGAGACGCCGCCGACCTCGGCATGGTGGCCGCCGGGCATCCGCTGCTCGGTGCCTGTGTG
GAACTCGCGGAGAGCGACTCGTACTTGTTCACCGGGCGGCTCTCGCGCAGGGCTCCGTCC
TGGCTGGCCGAACACGTGGTGGCGGGGACGGTTCTGGTGCCGGGTGCGGCGTTGGTGGAG
TGGGTGCTGCGGGCCGGCGATGAGGCGGGATGCCCGACGATTGAGGAACTGACGCTCCAG
GCGCCGTTGGTGCTGCCCGAGTCGGGCGGGTTGCAGGTTCAGGTGGTCGTGGGTGCGACC
GATGAGCAGAGCGGCCGTCGTGACGTACACGTGTATTCGAGGTCTGAGCAGGACGCGTCG
GCGGTGTGGGTGTGCCATGCCGTCGGTGTGGTGAGCTCCGAAATGCCAGAAGCGGCAGCC
GAGTTGAGTGGGCAGTGGCCTCCTGCCGGGGCCGAAGCCGTGGATGTCGAGGACTTCTAC
GCGCGGGCCGCGGAGGCCGGATACGCCTACGGTCCGGCGTTCCAGGGGCTGCGGGCGCTG
TGGCGGCACGGGACGGAGCTGTTCGCCGAGGTGGTGCTGCCCGAACAGGCGGGTGGGCAC
GACGGTTTCGGCATCCACCCGGCGCTGCTGGACGCCGCCCTGCATCCGCTGATGCTCCTC
GACCGGCCCGCGGACGGGCAGATGTGGCTGCCGTTCGCGTGGAGCGGGGTGTCGCTGAAC
GCGGACCGGGCGACCCACGTCCGTGTCCGGCTCTCCCCGCGGGGGGAGGCGGCCGAGCGT
GACCTGCGGGTCGTCATCGCCGACGCGACCGGCGCGCCCGTCCTGACGGTCGACGCCCTG
ACCCTGCGCGCGGCCGATCCCGGCCGGCTGGGTGCGGCGGCCCGTGGCGGTGTCGACGGC
CTCTACACCGTCGACTGGACCCCGCTGCCCCTGCCCCAGCCCCTTCCGCTGCCGCGGACG
GATGCAGGGGGGAGTGCCGACTGGGTCATACTCTCGGACAACTCCAGTGCAGCTCTGGCT
GATGCCGTGTCGTCCGCGACGGCGGCAGGTGGCGGAGCGCCGTGGGCATTGCTCGCTCCC
GTGGGTGGCGGCTCTGCCGATGACGGGCTGCCGGTGGTGCGGCGGACCCTCTCCCTCGTA
CAGGAGTTCCTGGCCGCCCCGGAGCTGACCGAGTCCCGTCTCGTCATCGTGACACGCGGT
GCCGTGGCCACCGACGCCGATGGTGACGTCGCGGCGTCCGCGGCAGCGGTATGGGGCCTG
ATCCGCAGCGCCCAGTCGGAGAACCCGGGCCGCTTCGTCCTGCTCGACGTCGAGGAGGAG
CACCTCCACCCGGACGGCGGGGAACTGCCGTACGCCGCCCTGCGCCACGCCGTAGAGGAG
CTCGACGAGCCTCAACTTGCCCTCCGCAGCGGCAAATTCCTCGTACCGCGCATGACGCCC
GCCGCCGCCCCCGAGGAGCTCGTCCCGCCGGTCGGTACGTCCGGCTGGCGCCTCGGCACC
TCCGGTACGGCCACCCTGGAGAATCTGTCGGTGATCGACGCTCCCGAGGCGTTCGCGCCG
CTGGAGCCCGGGCAGGTGCGGATCTCCGTACGGGCGGCGGGCATGAACTTCCGTGACGTG
CTGATCGCGTTGGGCATGTATCCCGACAAGGGCACGTTCGCGGGAAGCGAGGGCGCCGGA
CATGTGACGGAGGTGGGACCGGGCGTCACTCATCTGTCGGTCGGTGACCGGGTGATGGGT
CTGTTCGAGGGCGCGTTCGCTCCGCTGGCCGTCGCGGACGCCCGGATGGTCGTCCCGATT
CCGGAGGGCTGGAGCTTCCAGGAGGCCGCGGCGGTGCCCGTGGTGTTCCTCACGGCCTGG
TACGGCCTCGTGGACCTCGGCCGCCTCCGGGCGGGCGAATCGCTGCTCATCCACGCGGGC
ACCGGCGGAGTGGGCATGGCCGCCACCCAGATCGCCCGCCACCTGGGCGCCGAGGTGTTC
GCCACCGCGAGCCCCGCCAAGCACGGCGTGCTCGACGGCATGGGCATCGACGCGGCCCAC
CGCGCCTCCTCCCGTGACCTCGACTTCGAGGAGACCTTGCGGGCGGCGACGGGCGGGCGC
GGCATGGACGTCGTACTCAACAGTCTGGCCGGGGAGTTCACCGACGCCTCGCTGCGGCTG
CTCGCCGAGGGCGGGCGCATGGTGGACATGGGCAAGACCGACAAGCGCGACCCCGACCGG
GTCGCGGCCGAGCACGCGGGCGCGTGGTACCGGGCCTTCGACCTCGTGCCGCACGCGGGG
CCCGACCGGATCGGGGAAATGCTGGCGGAGCTGGGCGAGTTGTTCGCCTCCGGCGCCCTG
GCGCCGCTGCCCGTCCAGACCTGGCCGCTGGGCCGGGCGCGTGAGGCGTTCCGGTTCATG
AGCCAGGCGAAGCACACCGGCAAGCTGGTGCTGGAGATCCCGCCCGCCCTCGATCCGGAC
GGCACGGTGCTCATCACCGGCGGCACCGGGGTCCTCGCCGCCGCGGTGGCCGAGCATCTG
GTGAGGGAGTGGGGCGTACGACACCTGCTGCTGGCCGGGAGGCGCGGTTCCGAGGCGCCC
GGGAGCAGTGAACTCGCCGAGGAACTGACCGAGTTGGGGGCCGAGGTGACCTTTGCCGCG
GCCGATGTCAGTGATCCGGACGCCGTGGCGGAGCTCGTCGGCAAGACCGATCCGGCGCAC
CCGCTGACCGGTGTGATCCACGCGGCCGGTGTGCTGGACGACGCCGTGGTCACCGCACAG
ACCCCGGAGAGCCTCGCGCGGGTGTGGGCGGCGAAGGCGACGGCCGCACACCTGCTGCAC
GAGGCGACCCGGGAGGCGCGCCTCGGTCTCTTCCTGGTGTTCTCCTCGGCGGCGGCGACA
CTCGGCAGTCCGGGACAGGCCAACTACGCGGCGGCCAACGCCTATTGCGACGCCCTCGTC
CGGCAACGGCGTGCCGAGGGCCTGGCCGGTCTCTCGATCGGCTGGGGTCTGTGGCAGACG
GCGAGCGGCATGACCGGACACCTCGGCGAGACGGACCTGGCACGCATGAAGCGCACCGGG
TTCACCCCGCTGACCACCGAAGGTGGCTTGGCCCTCCTCGACGCCGCCCGCGCCCACGGC
CGCCCGCACGTGGTCGCGGTGGACCTCGACGCGCGCGCCGTCGCCGCGCAGCCCGCCCCG
TCCCGGCCCGCGCTCCTGCGCGCCCTGGCCGCGGGTGCGACCCCGGGGGCCCGCACCGCC
CGGCGCACCGCGGCCGCGGGCAGCGTCGCCCCGGCGGGCGGTCTCGCCGACCGGCTCGCC
GGCCTGCCGCATCCCGAACGGCGCCGGCTGCTGCTCGACCTCGTACGTGGCAACGTCGCC
GGCGTCCTCGGGCACAGCGACCACGACGCCGTCCGCCCGGACACGTCGTTCAAGGAGCTC
GGCTTCGACTCCCTGACCGCCGTGGAACTGCGCAACCGGCTGGCCGCCGCCACCGGCCTG
AAGCTGCCCGCGGCGCTCGTCTTCGACTACCCCGAGTCGGCCACCCTCGTCGACCACCTC
CTGGAGCGTCTGTCGCCCGACGGCGCGCCGCCGCCCGTCAAGGACGCCGCGGACCCCGTT
CTCAACGACCTCGGCAGGATCGAGTCCTCCCTGGACGCGCTCGCCCTCGACGCGGACGCG
CGCAGCCGGGTCACCAGGCGTCTGAACACCCTGCTGTCGAAGCTGAACGGAGCCGCCACC
GCCGGCTCCCCGGCGGACGTCACGGACCTGGACGCGCTGGACGCGCTGGACGACGTGTCC
GACGACGAGATGTTCGAGTTCATCGACCGAGAGCTGTGA
[3] KS34..405
[3] AT609..932
[3] malonyl-CoA802..806
[3] DH981..1198
[3] KR1576..1756
[3] ACP1873..1943
[4] KS1975..2351
[4] AT2507..2824
[4] methylmalonyl-CoA2695..2699
[4] DH2873..3037
[4] ER3364..3671
[4] KR3681..3861
[4] ACP3971..4041
[3] KS100..1215
[3] AT1825..2796
[3] malonyl-CoA2404..2418
[3] DH2941..3594
[3] KR4726..5268
[3] ACP5617..5829
[4] KS5923..7053
[4] AT7519..8472
[4] methylmalonyl-CoA8083..8097
[4] DH8617..9111
[4] ER10090..11013
[4] KR11041..11583
[4] ACP11911..12123

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [601-734]  G3DSA:3.40.366.10 [802-923]  G3DSA:3.40.366.10 [2500-2628]  G3DSA:3.40.366.10 [2695-2813]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [3681-3848]  3.29999999999997e-57 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1901-1916]  PS00012 [3999-4014]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1866-1991]  4.80000830876748e-27 SSF47336 [3962-4048]  2.49999811956465e-23 SSF47336
SSF47336   ACP_like
 [1876-1942]  2.6e-12 PF00550 [3975-4040]  4.9e-11 PF00550
PF00550   PP-binding
 [1872-1948]  4.39999999999997e-46 G3DSA:1.10.1200.10 [3970-4045]  4.39999999999997e-46 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1873-1943]  PS50075 [3971-4041]  PS50075
PS50075   ACP_DOMAIN
IPR011032 GroES-like (Domain)
 [3355-3499]  4.79998722798115e-34 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [3503-3599]  2.8e-17 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [3383-3440]  2e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1576-1755]  4.5e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-282]  1.10000000000001e-87 PF00109 [1975-2226]  1e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [290-405]  3.7e-47 PF02801 [2235-2351]  1.09999999999999e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [609-932]  2.89999999999999e-60 PF00698 [2507-2824]  3.90000000000001e-104 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  5.40000000000001e-13 PF08990
PF08990   Docking
 [4-34]  7.80000016938413e-07 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [606-896]  5.50001754266469e-67 SSF52151 [2505-2807]  2.30000440726534e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [736-801]  2.70000183580794e-17 SSF55048 [2630-2694]  2.39999798157265e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-293]  G3DSA:3.40.47.10 [294-463]  4.10000000000004e-129 G3DSA:3.40.47.10 [1975-2236]  G3DSA:3.40.47.10 [2238-2405]  4.10000000000004e-129 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-463]  2.59998233910302e-101 SSF53901 [1967-2404]  1.19999063421924e-105 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1574-1764]  8.70000000000003e-78 G3DSA:3.40.50.720 [3455-3647]  3.2e-56 G3DSA:3.40.50.720 [3681-3862]  8.70000000000003e-78 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [195-211]  PS00606 [2139-2155]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [610-915]  2.0000139277205e-127 SM00827 [2509-2804]  1.19999063421924e-113 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1874-1946]  1.79999754022375e-33 SM00823 [3972-4044]  1.79999754022375e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [981-1198]  6.40004254961849e-69 SM00826 [2873-3037]  1.69998802370953e-85 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  SM00825 [1977-2404]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1576-1756]  4.19999771339582e-64 SM00822 [3681-3861]  2.19999900980707e-54 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [3364-3671]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit