close all open/close all

CDS information : Monen_00180


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction42,448 / 54,564 / + [in whole cluster]
42,448 / 54,564 / + [in contig]
Location42448..54564 [in whole cluster]
42448..54564 [in contig]
TypeCDS
Length12,117 bp (4,038 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)monensin polyketide synthase modules 5 and 6
Gene
Gene (GenBank)monAIV
EC number
Keyword
Note
Note (GenBank)
  • MonAIV
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
[25044264] Predicted incorporation of non-native substrates by a polyketide synthase yields bioactive natural product derivatives. (Chembiochem. , 2014)

close this sectionPKS/NRPS Module

5 A: ethylmalonyl-CoA
B: methylmalonyl-CoA
6 malonyl-CoA
KS60..433
AT593..910
DH959..1133
KR1449..1629
ACP1728..1798
KS1833..2209
AT2377..2696
DH2744..2910
ER3239..3545
KR3555..3735
ACP3877..3950

close this sectionSequence

selected fasta
>polyketide synthase [monensin polyketide synthase modules 5 and 6]
MSSAEESSPDVSGTGVSGTGESATGTSSTEAKLRQYLKRVTVDLGQARRRLREVEERAQE
PIAIVSMACRFPGDTRTPEALWDLVAEGGDAIDDFPTNRGWDLESLYHPDPDHPGTSYVR
RGGFLYDAPAFDASFFGISPREALAMDPQQRVLMETAWQLLERAGIDPASLKLSATGVYI
GAGVLGFGGAQPDKTVEGHLLTGSALSVLSGRISFTLGLEGPSVSVDTACSSSLVSMHLA
AQALRQGECDLALAGGVTVMSTPGAFTEFSRQGALSPDGRSKAFAASADGTGFSEGAGLL
LLERLSDARRNGHKVLAVIRGSAVNQDGASNGLTAPNGPSQERVIRAALANAGLGAAEVD
AVEAHGTGTKLGDPIEAGALLATYGRDRDEDRPLWLGSVKSNIGHPQGAAGVAGVIKMVM
ALQRELLPATLYVDEPTPHVDWSSGSVRLLTEPVPWTRGERPRRAGVSAFGMSGTNAHVI
LEEAPPEEAAAAETPAEGTGAVVPWVVSGRGEEALRAQAAQLAEHVRDDDQRPASPLEVG
WSLATTRSVFENRAVVVGDDRDALLDGLRSLAAGEASPDVVSGAVGPTGPGPVMVFPGQG
GQWVGMGARLLDESPVFAARIAECEQALSAYVDWSLTDVLRGDGSELARIDVVQPVLWAV
MVALAAVWADQGIEPAAVVGHSQGEIAAACVVGAISLDEAARIVAVRSVLLRQLSGRGGM
ASLGMGQEQAADLIDGHPGVVVAAVNGPSSTVISGPPEGIAAVVADAQERGLRARAVASD
VAGHGPQLDAILDQLTEGLAGIRPAATDVAFYSTVTAGHLTDTTELDTAYWVRNVRRTVR
FADTIDALLADGYRLFIEVSPHPVLNLALEGLIERAAVPATVVPTLRRDHGDTTQLARAA
AHAFAAGADVDWRRWFPADPAPRTVDLPTYAFQRQDFWPAPAGGRSGDPAGLGLAASGHP
LLGASVGLASGDVHLLSGRVSRQSAAWLDDHVVAGQALVPGAAQVEWVLRAGDDAGCSAL
EELTLQTPLVLPDTGGLRIQVVVEAADAHGRRDVRLFSRPDDDDAFASTHPWTCHATGVL
APAPTDGTNGTRDAADTLDGAWPPADAEPVPADDLYAQADRTGYGYGPAFRGVRALWRHG
KDVLAEVTLPKEAGDPDGFGIHPALLDAVLQPAALLLPPTDAEQVWLPFAWNDVALHAVR
ATTVRVRLTPLGERIDQGLRITVADAVGAPVLTVRDLRSRPTDTGRLAAAATRDRHGLFD
LEWIAPENAAENAAGPARDASEGWVTLGEDAASLADLLASVEAGAPAPQLVAAPVEPDRT
DDGLALATHVLDLVQTWLASPLHDSRLVLVTRGAVTDADVDVAAAAVWGLVRSAQSEHPG
RFTLIDLGPDDTLAAAMQAAHLEEPQLAVHGGEIRVPRLVRATTDPTAPNGTPEADRTAD
PSEGLHRNGTVLITGGTGVLGRLVAEHLVTEWGVRHLLLASRRGDQAPGSAELRARLSEL
GASVEIAPADVGDAEAVAALIASVDPAHPLTGVIHAAGVLDDAVITAQTPESLARVWATK
ATAARHLHEATRETPLDFFVVFSSAAASLGSPGQANYAAANAYCDALVQHRRAQGLAGLS
IAWGLWQATSGMTGQLSETDLARMKRTGFAALTDEGGLALLDAARAHDRAYVVAADLDPR
AVTDGLSPLLRALTAPATRRRVASEGLADGALATRLAGLDADGRLRLLTDVVREYVAAVL
GHGSAARVGVDIAFKDLGFDSLTAVELRNRLSAACDVRLPATLIFDHPTPQALATHLVDR
LAGSTSATTTVNATAPAAAHVAAGADVDADTDDPVAIVAMTCRFPGGVASPDDLWDLLDA
RKDAMGAFPTDRGWDLERLFHPDPDHPGTSYTDQGGFLPDAGDFDAAFFGINPREALAMD
PQQRLLLEASWEVLERAGIDPTTLKGTPTGTYVGLMYHDYAKSFPTADAQLEGYSYLAST
GSMVSGRVAYTLGLEGPAVTVDTACSSSLVSIHLATQALRHGECDLALAGGVTVMADPDM
FAGFSRQRGLSPDGRCKAYAAAADGVGFSEGVGVLLLERLSDARRHGRRVLGVVRGSAVN
QDGASNGLTAPNGPSQERVIRQALASGGLSSVDVDVVEGHGTGTTLGDPIEAQALLATYG
QGRPEDRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGVVPASLHVDVPSPHVEWDSG
AVRLAVESVPWPQVEGRPRRAGVSSFGASGTNAHVIVESVPDGLEEDSVSVGGEALETET
DGRLVPWVVSARSPQALRDQALRLRDFASDASFRAPLADVGWSLLKTRALHEHRAVVVGA
ERAELIAALEALATGEPHAALVGPACSQARVGGDDVVWLFSGQGSQLVGMGAGLYERFPV
FAAAFDEVCGLLEGPLGVEAGGLREVVFRGPRERLDHTVWAQAGLFALQVGLARLWESVG
VRPDVVLGHSIGEIAAAHVAGVFDLADACRVVGARARLMGGLPEGGAMCAVQATPAELAA
DVDGSAVSVAAVNTPDSTVISGPSDEVDRIAGVWRERGRKTKALSVSHAFHSALMEPMLA
EFTEAIRGVKFRQPSIPLMSNVSGERAGEEITDPEYWARHVRNAVLFQPAIAQVADSAGV
FVELGPAPVLTTAAQHTLDESDSQESVLVASLAGERPEESAFVEAMARLHTAGVAVDWSV
LFAGDRVPGLVELPTYAFQRERFWLSGRSGGGDAATLGLVAAGHPLLGAAVEFADRGGCL
LTGRLSRSGVSWLADHVVAGAVLVPGAALVEWALRAGDEVGCVTVEELMLQAPLVVPEAS
GLRVQVVVEEAGEDGRRGVQIYSRPDADAVGGDDSWICHATGVLSPESARLDTELGGVWP
PAGAEPLDVDGFYAQAGEAGYGYGPAFRGLRAVWRHGQDLLAEVVLPEAAGAHDGYGIHP
ALLDATLHPLLAARFMDGSEDDQLYVPFGWAGVSLRAVGATTVRVRLRPVGESVDQGLSV
TVTDATGGPVLSVDSLQTRPVKPSQLAAAQQPDVRGLFTVEWTPLPQTDADGEADWVVLS
DGVGRLADVVSAAGGEAPWAVVAPVDASVGDGREGLDGRLVVERVLSLVQEFLALPELAE
SRLLVVTRGAVATGVDGDGDVDASAAAVWGLVRSAQSENPGRFILLDVDGDGDDQGPDLN
GRHLPHATLRHAAEELDEPQLALREGTLYVPRLTQARQSAELVVPPGEPAWRLRMVHDGS
LDALAAVACPEALEPLAPGQVRIAVHAAGINFRDVLVALGMVPAYGAMGGEGAGVVTEVG
PEVTHVSVGDRVMGVFEGAFGPVVIAEARMVTPVPQGWDMREAAGIPAAFLTAWYGLVEL
AGLKAGERVLVHAATGGVGMAAVQIARHVGAEVFATASPGKHAVLEEMGIDAAHRASSRD
LAFEGTFREATGGRGMDVVLNSLAGEFIDASLRLLGDGGRFLEMGKTDVRAAEEVAAEHA
DVSYTAYDLVGDAGPDRISNMLDKLVELFASERLKPLPVRSWPLDKAQEAFRFMSQAKHT
GKLVLEIPPALDPEGTVLVTGGTGALGQVVAEHLVREWGVRHLLLASRRGPEAPGSDELA
SKLTGLGAEVTIVAADVSDPASVVELVGKTDPSHPLTGVVHAAGVLEDGVVTAQTPEGLA
RVWAAKAAAAANLHEATREMRLGLFVVFSSAAATLGSPGQANYAAANAYCDALMQHRRAV
GQVGLSVGWGLWEAPDAKPGVAADAKASAATVGKASALSDGTNGSAPQDTTGTAPQGMTG
GLTDTDVARMARIGVKGMSNAHGLALFDAAHRHGRPHLVGFNLDLRTLATHPLHTRPALL
RGLATPTAGGASRPTATAGGQPADLAGRLAALSPSDRHHTLVRLIREQAATVLGHHPDSL
TTGSTFKELGFDSLTAVELRNRLSAATGLRLPAGLVFDHPDADILAEHLGAQLAPDGDTP
AGAEATDPVLRDLAKLENALSSTLVEHLDADAVTARLEALLSNWKAASAAPGSGSTKEQL
QVATTDQVLDFIDKELGV
selected fasta
>polyketide synthase [monensin polyketide synthase modules 5 and 6]
ATGTCGAGTGCTGAAGAGTCGAGTCCTGATGTGTCCGGCACGGGTGTGTCCGGTACGGGA
GAGTCCGCTACGGGTACGTCGAGTACGGAAGCCAAGCTTCGGCAGTATCTGAAGCGGGTC
ACGGTGGACCTCGGCCAGGCCCGCCGGCGGCTGCGCGAGGTGGAGGAGCGGGCCCAGGAG
CCGATCGCCATCGTCTCCATGGCGTGCCGCTTCCCCGGCGACACCCGCACGCCCGAGGCC
CTGTGGGACCTGGTCGCCGAGGGCGGCGACGCCATCGACGACTTCCCCACCAATCGCGGC
TGGGACCTGGAGAGCCTCTACCACCCCGACCCCGACCACCCCGGCACCAGCTACGTCCGA
CGCGGCGGGTTCCTGTACGACGCCCCCGCCTTCGACGCGTCGTTCTTCGGGATCAGCCCG
CGCGAAGCCCTGGCCATGGACCCGCAGCAGCGGGTGCTCATGGAGACGGCCTGGCAGCTC
CTGGAGCGGGCCGGCATCGACCCGGCCTCGCTGAAGCTGAGCGCCACCGGCGTCTACATC
GGCGCGGGCGTGCTCGGGTTCGGCGGCGCGCAGCCCGACAAGACGGTAGAGGGCCACCTC
CTGACCGGCAGCGCGCTGAGTGTCCTGTCCGGCCGCATCTCCTTCACGCTCGGCCTCGAG
GGCCCGTCGGTCAGTGTCGACACGGCGTGCTCCTCCTCGCTGGTCTCCATGCACCTGGCG
GCCCAGGCGCTGCGGCAGGGGGAGTGCGATCTCGCGCTGGCCGGCGGTGTCACCGTGATG
TCGACGCCCGGCGCGTTCACCGAGTTCTCCCGCCAGGGCGCGCTGTCTCCGGACGGCCGC
TCGAAGGCTTTCGCGGCCTCGGCCGACGGCACCGGTTTCTCGGAGGGCGCGGGACTGCTC
CTCCTGGAGCGGCTCTCCGACGCGCGCCGCAACGGCCACAAGGTGCTCGCGGTGATCCGC
GGCTCGGCCGTCAACCAGGACGGCGCGAGCAACGGTCTCACCGCCCCCAACGGCCCCTCC
CAGGAACGCGTGATCCGCGCCGCCCTCGCCAACGCGGGCCTGGGCGCCGCCGAGGTCGAC
GCGGTCGAGGCACACGGCACCGGCACGAAGCTCGGCGACCCCATCGAGGCCGGTGCGCTG
CTCGCCACCTACGGCCGCGACAGGGACGAGGACCGGCCGCTGTGGCTGGGCTCGGTCAAG
TCGAACATCGGTCACCCGCAGGGCGCAGCAGGCGTCGCGGGCGTCATCAAGATGGTGATG
GCGCTGCAGCGCGAACTGCTCCCCGCCACCCTGTACGTCGACGAGCCCACCCCGCACGTC
GACTGGTCCTCGGGCTCCGTCAGGCTCCTCACCGAACCGGTCCCGTGGACCCGCGGCGAG
CGCCCGCGCCGCGCGGGCGTGTCCGCCTTCGGCATGTCCGGGACGAACGCCCACGTGATC
CTGGAGGAGGCACCGCCCGAGGAGGCAGCGGCCGCGGAGACACCGGCGGAAGGGACAGGC
GCAGTCGTCCCGTGGGTCGTCTCCGGCCGGGGCGAGGAAGCGCTGCGGGCCCAGGCCGCA
CAGCTCGCCGAGCACGTGCGCGACGACGACCAGCGGCCGGCGTCACCGCTGGAGGTGGGG
TGGTCGCTCGCCACGACACGGTCGGTGTTCGAGAACCGGGCCGTCGTCGTCGGGGACGAC
CGCGACGCGCTCCTCGACGGCCTCCGGTCGCTGGCGGCAGGTGAGGCGTCGCCGGACGTG
GTGTCCGGGGCGGTCGGCCCCACGGGGCCCGGGCCGGTCATGGTGTTCCCCGGCCAGGGC
GGCCAGTGGGTGGGCATGGGGGCCCGGCTCCTCGACGAGTCCCCGGTGTTCGCGGCCCGG
ATCGCCGAGTGCGAGCAGGCCCTGTCGGCGTACGTGGACTGGTCCCTGACCGACGTGCTG
CGCGGGGACGGGTCGGAGCTGGCCCGGATCGACGTCGTCCAGCCCGTGCTGTGGGCCGTC
ATGGTCGCGCTCGCCGCCGTCTGGGCGGACCAGGGAATCGAACCCGCCGCCGTCGTCGGC
CACTCGCAGGGCGAGATAGCCGCGGCGTGCGTCGTGGGCGCCATCTCCCTGGACGAGGCG
GCCCGCATCGTCGCCGTACGCAGTGTGCTGCTGCGGCAGCTGTCCGGACGCGGCGGCATG
GCGTCCCTGGGGATGGGCCAGGAGCAGGCCGCCGACCTGATCGACGGACACCCGGGTGTG
GTCGTCGCGGCCGTCAACGGGCCGTCGTCCACCGTCATCTCGGGCCCGCCCGAGGGCATC
GCCGCCGTCGTCGCCGACGCCCAGGAGCGGGGCCTTCGCGCCAGGGCCGTCGCCTCCGAC
GTCGCGGGCCACGGCCCGCAGCTGGACGCGATCCTGGACCAGCTCACGGAGGGCCTGGCC
GGCATCCGGCCCGCCGCGACCGACGTCGCGTTCTACTCCACCGTCACCGCCGGGCACCTC
ACCGACACCACCGAACTCGACACCGCGTACTGGGTGCGGAACGTGCGCCGGACGGTGCGT
TTCGCCGACACGATCGACGCGCTGCTCGCGGACGGGTACCGCCTGTTCATCGAGGTGAGC
CCCCACCCCGTCCTCAACCTCGCGCTGGAAGGCCTCATCGAACGGGCGGCCGTGCCCGCC
ACGGTCGTGCCCACCCTGCGCCGCGACCACGGCGACACCACCCAGCTCGCCCGCGCCGCG
GCCCACGCCTTCGCCGCCGGCGCGGACGTCGACTGGCGGCGCTGGTTCCCGGCCGACCCC
GCCCCCCGTACCGTCGACCTGCCCACCTACGCCTTCCAGCGCCAGGACTTCTGGCCGGCC
CCCGCCGGCGGGCGGTCCGGCGACCCTGCCGGGCTCGGCCTCGCCGCCTCCGGACACCCG
CTCCTGGGCGCCTCCGTGGGCCTCGCGAGCGGGGACGTACACCTGCTGAGCGGGCGGGTG
TCCCGGCAGTCCGCCGCGTGGCTGGACGACCACGTCGTGGCGGGCCAGGCCCTGGTGCCC
GGCGCGGCGCAGGTGGAGTGGGTGCTGCGGGCCGGCGACGACGCGGGCTGCTCCGCCCTG
GAGGAGCTGACGCTCCAGACGCCGCTCGTGCTGCCCGACACCGGCGGCCTGCGGATCCAG
GTCGTCGTCGAAGCGGCCGACGCACACGGCCGGCGCGACGTCCGGCTGTTCTCCCGCCCC
GATGACGACGACGCCTTCGCGTCGACGCACCCCTGGACCTGCCACGCCACGGGCGTGCTC
GCCCCCGCCCCGACGGACGGCACCAACGGAACGCGGGACGCCGCCGACACCCTGGACGGC
GCATGGCCCCCGGCCGACGCCGAACCCGTCCCCGCCGACGACCTCTACGCGCAGGCCGAC
CGCACCGGATACGGCTACGGCCCCGCCTTCCGGGGCGTACGGGCGCTGTGGCGCCACGGC
AAGGACGTCCTGGCCGAGGTGACGCTGCCCAAGGAGGCCGGCGACCCGGACGGCTTCGGT
ATCCACCCGGCCCTCCTCGACGCCGTCCTGCAACCCGCCGCACTGCTGCTGCCCCCGACC
GACGCCGAACAGGTCTGGCTGCCGTTCGCCTGGAACGACGTGGCGCTGCACGCCGTACGG
GCCACCACGGTCCGGGTGCGCCTCACCCCGCTCGGCGAGCGGATCGACCAGGGGCTGCGC
ATCACCGTGGCCGACGCCGTGGGCGCGCCCGTGCTCACCGTCCGCGACCTGCGCTCGCGC
CCGACCGACACAGGCCGCCTCGCCGCGGCCGCGACCCGCGACCGGCACGGGCTGTTCGAC
CTGGAGTGGATCGCGCCGGAGAACGCGGCGGAGAACGCGGCGGGTCCGGCCCGGGACGCG
TCCGAAGGGTGGGTGACACTCGGCGAGGACGCCGCGAGCCTCGCGGACCTGCTGGCGTCC
GTCGAGGCGGGCGCTCCGGCGCCGCAGCTCGTGGCCGCCCCCGTCGAACCCGACCGGACC
GACGACGGCCTGGCACTCGCCACCCACGTCCTCGACCTCGTACAGACCTGGCTCGCCTCG
CCCCTGCACGACTCCCGCCTGGTCCTGGTGACGCGAGGGGCAGTGACGGATGCGGATGTG
GATGTGGCTGCCGCGGCCGTTTGGGGTCTGGTACGCAGCGCCCAGTCGGAGCACCCCGGC
CGCTTCACGCTGATCGACCTCGGCCCCGACGACACGCTTGCCGCAGCCATGCAGGCGGCG
CACCTGGAAGAGCCGCAACTGGCGGTGCACGGCGGCGAGATACGAGTGCCGCGACTGGTC
CGCGCCACGACCGACCCGACCGCCCCGAACGGGACACCGGAGGCCGACCGGACGGCGGAC
CCGTCCGAAGGACTCCACCGGAACGGTACGGTTCTCATCACCGGCGGCACCGGCGTACTC
GGCCGACTGGTGGCCGAACACCTGGTCACGGAGTGGGGCGTACGCCACCTGCTGCTCGCG
AGCCGACGCGGCGACCAGGCGCCGGGTAGCGCCGAACTCCGCGCCCGCCTGAGCGAATTG
GGAGCATCGGTCGAGATCGCCCCGGCCGATGTCGGCGACGCGGAAGCGGTCGCCGCACTG
ATCGCGTCGGTCGACCCGGCGCACCCGCTCACCGGTGTGATCCACGCGGCCGGTGTCCTG
GACGACGCCGTGATCACCGCCCAGACCCCCGAGAGCCTCGCGCGGGTGTGGGCGACGAAG
GCGACGGCGGCCCGCCATCTGCACGAGGCGACACGGGAGACACCCCTCGACTTCTTCGTG
GTGTTCTCCTCGGCGGCCGCCTCGCTCGGCAGCCCCGGCCAGGCCAACTACGCGGCGGCC
AACGCCTATTGCGACGCCCTCGTCCAGCACCGCCGCGCCCAAGGGCTCGCGGGCCTCTCG
ATCGCCTGGGGCCTGTGGCAGGCGACCAGCGGCATGACCGGGCAGCTGAGCGAGACCGAC
CTGGCGCGCATGAAGCGCACCGGGTTCGCCGCGCTGACCGACGAGGGCGGCCTGGCCCTG
CTCGACGCCGCCCGTGCCCACGACCGGGCCTACGTGGTCGCGGCCGACCTCGACCCGCGC
GCCGTGACCGATGGCCTGTCCCCGCTCCTGCGCGCCCTCACGGCGCCCGCCACGCGGCGG
CGCGTGGCCTCCGAAGGCCTCGCCGACGGGGCGCTCGCGACCCGCCTGGCCGGCCTCGAC
GCGGACGGCCGCCTAAGGCTCCTCACCGATGTCGTACGCGAGTACGTCGCGGCCGTCCTC
GGCCATGGTTCCGCCGCCCGGGTGGGCGTCGACATCGCCTTCAAGGACCTGGGTTTCGAC
TCGCTGACCGCGGTGGAGCTGCGCAACCGGCTGTCGGCCGCCTGTGACGTGCGGCTGCCC
GCCACACTGATCTTCGACCACCCCACCCCGCAGGCTCTCGCCACCCACCTGGTGGACCGC
TTGGCGGGCAGCACCTCCGCGACCACGACGGTGAATGCGACGGCGCCGGCAGCCGCCCAC
GTCGCCGCAGGGGCCGACGTCGACGCAGACACCGACGACCCGGTCGCCATCGTCGCCATG
ACGTGCCGGTTCCCGGGCGGCGTCGCGTCCCCGGACGACCTGTGGGACCTGCTCGACGCA
CGCAAGGACGCGATGGGCGCCTTCCCCACCGACCGCGGCTGGGACCTGGAACGCCTCTTC
CACCCCGACCCGGACCACCCCGGCACCAGCTACACCGACCAGGGCGGATTTCTTCCCGAC
GCGGGTGATTTCGATGCGGCGTTCTTCGGGATCAATCCGCGGGAGGCGCTGGCGATGGAT
CCGCAGCAGCGGTTGTTGCTGGAGGCGTCGTGGGAGGTGTTGGAGCGTGCGGGTATCGAT
CCGACGACGCTCAAGGGCACCCCGACCGGCACCTACGTGGGCCTCATGTACCACGACTAC
GCCAAGTCCTTCCCCACGGCCGACGCCCAGTTGGAGGGCTACTCCTACTTGGCGAGCACC
GGCAGCATGGTCTCCGGCCGCGTCGCCTACACCCTGGGCCTTGAAGGTCCGGCGGTGACG
GTCGACACCGCGTGCTCCTCCTCCCTGGTCTCCATCCACCTGGCGACGCAGGCACTCCGG
CACGGCGAGTGCGACCTCGCCCTGGCAGGCGGTGTGACCGTCATGGCCGACCCGGACATG
TTCGCGGGCTTCTCGCGCCAGCGCGGCCTCTCACCTGACGGCCGCTGCAAGGCCTACGCC
GCCGCGGCCGACGGAGTCGGATTCTCCGAGGGAGTGGGCGTATTGCTCCTTGAGCGGTTG
TCGGATGCGCGGCGTCATGGGCGTCGGGTGTTGGGTGTGGTGCGGGGTTCGGCGGTGAAT
CAGGACGGTGCGAGTAATGGGTTGACGGCGCCGAATGGTCCGTCGCAGGAGCGGGTGATT
CGTCAGGCGTTGGCCAGTGGTGGGTTGTCGTCGGTGGATGTTGATGTGGTGGAGGGGCAT
GGGACGGGGACCACGTTGGGTGATCCGATCGAGGCGCAGGCTCTGCTGGCCACATATGGG
CAGGGGCGTCCGGAGGACCGTCCGTTGTGGTTGGGGTCGGTGAAGTCGAACATTGGTCAT
ACGCAGGCGGCTGCGGGTGTTGCGGGTGTCATCAAGATGGTGATGGCGATGCGGCATGGT
GTGGTGCCGGCGAGTTTGCATGTGGATGTGCCGTCGCCGCATGTGGAGTGGGATTCGGGT
GCGGTGCGGTTGGCGGTTGAGTCGGTGCCATGGCCGCAGGTGGAGGGTCGTCCGCGTCGG
GCGGGTGTGTCGTCGTTCGGCGCTTCGGGGACGAATGCGCACGTGATCGTGGAGTCTGTT
CCCGATGGGCTGGAGGAGGACTCGGTATCGGTCGGCGGTGAGGCTCTTGAGACGGAGACT
GACGGGCGCTTGGTGCCGTGGGTGGTGTCGGCCCGCAGCCCGCAGGCCCTGCGCGACCAG
GCACTACGCCTGCGTGACTTTGCCAGTGACGCGTCGTTCCGCGCGCCGCTCGCCGACGTG
GGCTGGTCGCTGCTGAAGACGCGTGCGCTGCATGAGCATCGCGCCGTTGTGGTGGGCGCG
GAGCGGGCAGAGCTGATCGCCGCTCTGGAGGCGCTGGCGACGGGTGAGCCGCATGCGGCG
CTGGTCGGCCCGGCTTGCTCGCAGGCTCGGGTGGGTGGCGATGACGTGGTGTGGCTGTTC
AGTGGTCAGGGCAGTCAGTTGGTCGGTATGGGTGCTGGTTTGTATGAGCGGTTCCCGGTG
TTTGCGGCTGCGTTTGATGAGGTGTGCGGCCTGTTGGAGGGGCCGTTGGGCGTGGAGGCG
GGTGGGTTGCGGGAGGTGGTGTTCCGTGGCCCGCGGGAGCGGTTGGATCACACGGTGTGG
GCGCAGGCGGGGTTGTTTGCGCTGCAGGTGGGGTTGGCCCGGTTGTGGGAGTCGGTCGGG
GTGCGGCCGGATGTGGTGCTCGGGCATTCGATCGGTGAGATCGCGGCCGCGCATGTGGCG
GGGGTTTTTGATCTGGCGGATGCGTGTCGGGTGGTGGGTGCGCGGGCGCGTTTGATGGGT
GGGCTGCCTGAGGGTGGGGCGATGTGCGCGGTGCAGGCCACGCCCGCCGAGCTGGCCGCC
GACGTGGACGGATCGGCTGTAAGTGTGGCGGCAGTCAACACCCCCGACTCCACGGTGATT
TCGGGCCCGTCGGACGAGGTGGACCGGATTGCTGGGGTGTGGCGGGAGCGTGGGCGCAAG
ACGAAGGCGCTGAGCGTCAGTCATGCCTTCCATTCGGCGTTGATGGAGCCGATGCTCGCG
GAGTTCACCGAAGCGATACGAGGGGTCAAGTTCAGGCAGCCGTCGATCCCGCTCATGAGC
AATGTCTCCGGAGAGCGGGCCGGCGAGGAGATCACGGATCCGGAGTACTGGGCGAGGCAT
GTACGTAATGCGGTGCTCTTCCAGCCCGCCATCGCCCAAGTAGCGGATTCAGCGGGCGTG
TTTGTGGAGCTCGGCCCCGCGCCTGTGCTGACCACGGCCGCCCAGCACACCCTGGACGAG
TCGGACAGCCAGGAGTCGGTGCTGGTCGCGTCTCTCGCCGGTGAGCGTCCTGAGGAGTCG
GCGTTTGTGGAGGCGATGGCTCGTCTGCATACCGCTGGTGTTGCTGTGGACTGGTCGGTG
TTGTTCGCGGGTGATCGTGTGCCTGGGCTGGTGGAGTTGCCGACGTATGCGTTCCAGCGG
GAGCGGTTCTGGTTGAGTGGCCGTTCTGGGGGTGGGGATGCGGCGACTTTGGGGTTGGTG
GCGGCGGGGCATCCGTTGTTGGGTGCGGCGGTGGAGTTCGCGGACCGGGGTGGGTGTCTG
CTGACCGGTCGTCTGTCGCGGTCTGGGGTGTCGTGGCTTGCTGATCATGTGGTGGCGGGT
GCGGTTTTGGTGCCGGGTGCTGCGTTGGTGGAGTGGGCGTTGCGGGCCGGTGATGAGGTC
GGTTGTGTGACGGTGGAGGAGTTGATGTTGCAGGCGCCTTTGGTGGTGCCTGAGGCGTCG
GGTCTGCGGGTTCAGGTGGTGGTTGAGGAGGCGGGTGAGGACGGGCGGCGCGGTGTTCAG
ATCTACAGCCGGCCCGACGCGGACGCCGTGGGCGGCGATGACTCGTGGATCTGCCACGCG
ACCGGCGTACTGTCACCCGAAAGCGCTCGTCTGGACACGGAGTTGGGTGGCGTCTGGCCA
CCGGCCGGTGCCGAACCGCTGGATGTCGACGGCTTCTACGCGCAGGCCGGTGAGGCCGGG
TACGGATACGGTCCGGCGTTCCGGGGGCTGCGTGCCGTGTGGCGGCACGGCCAGGACCTG
CTGGCCGAGGTCGTCCTGCCCGAAGCCGCCGGTGCCCATGACGGCTACGGGATCCACCCC
GCCCTCCTCGACGCCACCCTCCATCCGCTGCTCGCCGCCCGCTTCATGGACGGTTCCGAG
GACGATCAGCTCTACGTACCGTTCGGGTGGGCCGGAGTGTCTCTGCGGGCGGTGGGAGCC
ACGACTGTGCGCGTGCGCCTCCGTCCGGTCGGGGAGAGCGTCGACCAAGGGCTGAGCGTG
ACGGTCACCGATGCGACCGGCGGTCCCGTTCTGAGCGTCGACTCCCTCCAGACCCGCCCC
GTGAAGCCGAGCCAATTGGCTGCGGCCCAACAGCCGGACGTACGCGGTCTGTTCACTGTG
GAGTGGACGCCGCTGCCGCAGACGGATGCCGACGGGGAGGCCGACTGGGTTGTGCTCTCG
GACGGTGTTGGCCGTCTGGCTGATGTGGTGTCGGCGGCGGGTGGTGAAGCGCCGTGGGCA
GTGGTCGCTCCTGTCGATGCGTCTGTGGGCGACGGCCGTGAGGGTCTTGACGGTCGGCTG
GTCGTGGAGCGGGTGCTGTCACTCGTACAGGAGTTCCTGGCCCTGCCGGAGCTGGCCGAG
TCCCGTCTCCTCGTGGTGACGCGCGGTGCGGTGGCCACCGGCGTCGACGGTGACGGTGAC
GTGGACGCGTCCGCCGCAGCTGTATGGGGCCTGGTCCGCAGTGCTCAGTCCGAGAATCCG
GGCCGCTTCATCCTGCTCGACGTGGACGGCGACGGCGACGACCAGGGCCCGGACCTGAAC
GGCCGGCATCTGCCCCACGCCACCCTGCGTCACGCCGCCGAGGAACTCGACGAGCCCCAA
CTCGCCCTGCGGGAAGGGACGCTCTACGTCCCCCGACTGACCCAGGCGCGCCAGTCCGCC
GAACTCGTCGTGCCGCCCGGTGAACCGGCGTGGCGCCTGCGGATGGTGCACGACGGCTCG
CTGGACGCCCTGGCGGCAGTGGCCTGCCCGGAGGCCCTGGAGCCCTTGGCGCCGGGGCAG
GTGCGTATCGCCGTACACGCCGCGGGCATCAACTTCCGTGACGTACTGGTGGCCTTGGGT
ATGGTCCCCGCGTACGGGGCCATGGGTGGCGAAGGTGCCGGTGTCGTGACGGAGGTCGGT
CCCGAGGTCACCCATGTCTCGGTGGGCGACCGCGTGATGGGCGTGTTCGAGGGCGCGTTC
GGCCCTGTGGTGATCGCCGAGGCGCGGATGGTCACACCTGTCCCGCAGGGCTGGGACATG
CGGGAGGCGGCCGGTATTCCGGCGGCCTTCCTGACGGCTTGGTACGGGTTGGTGGAGCTG
GCCGGTCTGAAGGCGGGCGAGCGGGTGCTGGTCCATGCCGCGACGGGTGGTGTGGGGATG
GCGGCGGTGCAGATCGCCCGGCATGTGGGTGCCGAGGTGTTCGCCACCGCGAGTCCGGGC
AAGCACGCCGTGCTGGAGGAGATGGGCATCGACGCCGCCCACCGCGCCTCCTCCCGGGAC
CTCGCCTTCGAGGGCACGTTCAGGGAAGCAACGGGCGGCCGCGGCATGGACGTCGTGCTC
AACAGCCTTGCCGGCGAGTTCATCGACGCCTCTCTGCGGTTGCTCGGCGACGGCGGCCGG
TTCCTGGAGATGGGCAAGACCGATGTGCGGGCCGCCGAAGAGGTGGCTGCGGAGCACGCG
GACGTCTCGTACACGGCGTACGACCTCGTCGGTGATGCCGGACCCGACCGCATCAGCAAC
ATGCTGGACAAGCTCGTCGAATTGTTCGCCTCAGAACGGCTTAAGCCGCTGCCGGTACGT
TCCTGGCCGCTGGACAAGGCGCAGGAGGCGTTCCGGTTCATGAGTCAGGCGAAGCACACC
GGCAAGCTGGTGCTTGAGATCCCGCCTGCCCTCGACCCCGAGGGCACGGTTCTGGTCACC
GGGGGCACCGGTGCGCTGGGGCAGGTCGTGGCCGAGCATCTGGTCCGGGAGTGGGGCGTA
CGGCACCTGCTGCTGGCCAGCCGTCGCGGTCCGGAGGCGCCGGGCAGCGACGAACTGGCC
TCGAAGCTCACCGGGTTGGGTGCCGAGGTCACCATTGTCGCGGCCGATGTCAGCGACCCG
GCCTCGGTGGTGGAGCTGGTCGGCAAGACGGATCCCTCGCATCCGTTGACGGGTGTCGTG
CACGCGGCGGGCGTGTTGGAGGACGGTGTCGTGACCGCTCAGACGCCTGAGGGGCTGGCG
CGGGTGTGGGCGGCCAAGGCTGCTGCGGCGGCGAATCTCCATGAGGCGACCCGGGAGATG
CGTCTCGGCCTGTTCGTGGTGTTCTCCTCGGCGGCCGCCACGCTCGGCAGTCCGGGCCAG
GCCAACTACGCGGCCGCCAATGCCTATTGCGACGCGCTGATGCAGCACCGACGGGCGGTG
GGCCAGGTCGGCCTGTCGGTCGGCTGGGGTCTCTGGGAGGCGCCGGACGCCAAGCCGGGT
GTTGCCGCCGACGCCAAGGCGAGTGCTGCCACCGTCGGCAAGGCGAGTGCTCTATCCGAC
GGCACGAACGGCAGCGCTCCCCAGGACACGACCGGCACCGCCCCCCAGGGCATGACCGGC
GGACTCACCGACACCGACGTAGCCCGCATGGCACGTATCGGCGTCAAGGGCATGAGCAAC
GCCCACGGTCTCGCCCTGTTCGACGCCGCGCACCGCCACGGCCGCCCCCACCTGGTCGGC
TTCAACCTCGACCTGCGCACCCTGGCCACGCACCCCCTGCACACCCGGCCCGCCCTTCTG
CGCGGCCTGGCCACCCCCACCGCCGGCGGGGCGAGCAGGCCGACCGCGACGGCGGGCGGA
CAGCCCGCCGACCTGGCGGGCCGGCTGGCCGCGCTGTCGCCGTCGGACCGGCACCACACG
CTGGTCCGGCTCATCAGGGAACAGGCCGCCACCGTGCTCGGGCACCACCCGGACAGTCTC
ACCACGGGCAGCACCTTCAAGGAACTCGGATTCGACTCCCTGACCGCGGTCGAACTGCGC
AACAGGCTGTCCGCCGCCACCGGTCTCCGGCTCCCCGCCGGCCTGGTCTTCGACCACCCG
GACGCCGACATCCTGGCCGAACACCTCGGCGCGCAACTCGCCCCCGACGGGGACACCCCC
GCCGGTGCGGAAGCCACCGACCCGGTCCTCCGCGACCTGGCGAAACTCGAGAACGCCCTC
TCCTCCACCCTCGTCGAGCACCTCGACGCCGACGCGGTCACGGCCCGACTGGAAGCACTC
CTGTCGAACTGGAAGGCGGCGAGCGCGGCGCCCGGCTCGGGCAGCACGAAGGAGCAGCTC
CAGGTTGCCACGACCGACCAGGTCCTCGACTTCATCGACAAAGAACTGGGTGTGTGA
[5] KS60..433
[5] AT593..910
[5] A: ethylmalonyl-CoA B: methylmalonyl-CoA781..785
[5] DH959..1133
[5] KR1449..1629
[5] ACP1728..1798
[6] KS1833..2209
[6] AT2377..2696
[6] malonyl-CoA2568..2572
[6] DH2744..2910
[6] ER3239..3545
[6] KR3555..3735
[6] ACP3877..3950
[5] KS178..1299
[5] AT1777..2730
[5] A: ethylmalonyl-CoA B: methylmalonyl-CoA2341..2355
[5] DH2875..3399
[5] KR4345..4887
[5] ACP5182..5394
[6] KS5497..6627
[6] AT7129..8088
[6] malonyl-CoA7702..7716
[6] DH8230..8730
[6] ER9715..10635
[6] KR10663..11205
[6] ACP11629..11850

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [589-714]  G3DSA:3.40.366.10 [781-899]  G3DSA:3.40.366.10 [2376-2499]  G3DSA:3.40.366.10 [2567-2672]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1449-1616]  1.5e-60 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1756-1771]  PS00012 [3908-3923]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1728-1802]  1.70000000000001e-43 G3DSA:1.10.1200.10 [3880-3954]  1.70000000000001e-43 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1721-1849]  1.39999892049878e-27 SSF47336 [3873-3967]  6.30000946287306e-22 SSF47336
SSF47336   ACP_like
 [1728-1798]  PS50075 [3877-3950]  PS50075
PS50075   ACP_DOMAIN
 [1731-1797]  2.2e-13 PF00550 [3884-3949]  2.1e-10 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [3233-3384]  8.70001261213514e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [3377-3496]  2.5e-19 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [3258-3314]  8.5e-09 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [3555-3733]  3.5e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [60-308]  1.20000000000001e-90 PF00109 [1833-2083]  7.90000000000016e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [316-433]  2.99999999999998e-45 PF02801 [2091-2209]  8.1e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [593-910]  1.20000000000001e-97 PF00698 [2377-2696]  3.90000000000001e-67 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [26-60]  2.00000075217457e-13 SSF101173
SSF101173   Polyketide_synth_docking
 [28-53]  7.4e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [591-893]  1.99999636034521e-60 SSF52151 [2375-2663]  1e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [716-780]  2.39999798157265e-15 SSF55048 [2504-2567]  1e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [62-320]  G3DSA:3.40.47.10 [321-488]  3.60000000000011e-129 G3DSA:3.40.47.10 [1835-2095]  G3DSA:3.40.47.10 [2096-2262]  3.60000000000011e-129 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [52-422]  2.50000909916183e-103 SSF53901 [1825-2262]  5.50001754266469e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1447-1636]  3.60000000000002e-68 G3DSA:3.40.50.720 [3329-3519]  7.00000000000005e-52 G3DSA:3.40.50.720 [3556-3735]  3.60000000000002e-68 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [221-237]  PS00606 [1996-2012]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [595-890]  8.6000633021393e-109 SM00827 [2379-2676]  1.09999184471405e-108 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1729-1801]  2.60000517657733e-35 SM00823 [3882-3953]  1.60000240695997e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [959-1133]  1.59998835313644e-73 SM00826 [2744-2910]  8.50003024809048e-82 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [62-486]  SM00825 [1835-2262]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1449-1629]  2.50000909916183e-63 SM00822 [3555-3735]  6.4999795054176e-56 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [3239-3545]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit