close all open/close all

CDS information : Monen_00190


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction54,614 / 66,934 / + [in whole cluster]
54,614 / 66,934 / + [in contig]
Location54614..66934 [in whole cluster]
54614..66934 [in contig]
TypeCDS
Length12,321 bp (4,106 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)monensin polyketide synthase modules 7 and 8
Gene
Gene (GenBank)monAV
EC number
Keyword
Note
Note (GenBank)
  • MonAV
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionPKS/NRPS Module

7 methylmalonyl-CoA
8 malonyl-CoA
KS34..408
AT563..879
DH927..1097
KR1482..1662
ACP1764..1834
KS1856..2232
AT2398..2720
DH2768..2935
ER3302..3608
KR3618..3798
ACP3943..4013

close this sectionSequence

selected fasta
>polyketide synthase [monensin polyketide synthase modules 7 and 8]
MASEEELVDYLKRVAAELHDTRQRLREVEDRRQEPVAVVGMACRFPGGIETPEGLWELVA
AGDDAIEPFPTDRGWDLEGIYHPDPDHPGTCYVREGGFLAAPDRFDSDFFGFSPREALAS
SPQLRLLLETSWEALERAGINPASLKGSPTGVYVGAATTGNQTQGDPGGKATEGYAGTAP
SVLSGRLSFTLGLEGPAVTVETACSSSLVAMHLAANALRQGECDLALAGGVTVMSTPEVF
TGFSRQRGLAPDGRCKPFAAAADGTGWGEGAGLILLERLSDARRKGHKVLAVIRGSAINQ
DGASNGFTAPNGPSQRRVIRQALSSAHLSTSEIDVVEAHGTGTRLGDPIEAEALIATYGK
EREDDRPLWLGSVKSNIGHTQAAAGVAGVIKMVMALQRELLPATLNVDEPTPHVQWEGGG
VRLLTEPVPWSRGERPRRAGISSFGISGTNAHVVLEEAPPEEDVPGPVAAEPEGVVPWVV
SARTEEALSEQARRLGEFVADTDPSTADVGWSLTTSRAILEHRAVVVGRDRDALTAGLAA
LAAGEESADVVAGVAGDVGPGPVLVFPGQGSQWVGMGAQLLDESPVFAARIAECEQALSA
YVDWSLSAVLRGDGSELSRVEVVQPVLWAVMVSLAAVWADYGVTPAAVIGHSQGEMAAAC
VAGALSLEDAARVVAVRSDALRQLMGQGDMASLGASSEQAAELIGDRPGVCIAAVNGPSS
TVISGPPEHVAAVVADAEERGLRARVIDVGYASHGPQIDQLHDLLTDRLADIRPATTDVA
FYSTVTAERLTDTTALDTDYWVTNLRQPVRFADTIDALLADGYRLFIEASAHPVLGLGME
ETIEQADIPATVVPTLRRDHGDTTQLTRAAAHAFTAGATVDWRRWFPADPTPRTIDLPTY
AFQRRSYWLPVDGVGDVRSAGLRRVEHSLLPAALGLADGALVLTGRLAASGGGGGWLADH
AVAGTTLVPGAALVEWALRAADEAGCPSLEELTLQAPLVLPGSGGLQVQVVVGPADGQGG
RREVRVFSRVDSDDEAAGQDEGWSCHATGVLSPEPGAVPDGLSGQWPPTGAEPLEISDLY
EQAASAGYEYGPSFRGLRSVWRHGHNLLAEVELPEQAGAHDDFGIHPVLLDAALHPALLL
DQNAPGEEQEPAQPALRLPFVWNGVSLWATGAATVRVRLAPHGGGETDDSAGLRVTVADA
TGAPVLSVDSLALRPADPELLRTAGRAGSGTNGLFTVEWTALPPADVADHAAGDGWAVLG
QDVPDWAGADMPRHPDMASLSAALDEGTQAPAAVFVETTATSHATPNTAADVTLDASGRA
VAERTLHLLRDWLAEPRLAETRLVLITHHAVTTPADDDVNAAPLDVPAAALWGLIRSAQA
EHPDRFVLLDTDAKANTDPGPDTSTDHSTASGTYRTVIARALATGEPQLAVRAGELLAPR
LARAATPTPETPTPETQPDTGSGSEAGAGSGSGPGATLDPDGTVLIAGGTGMMGGLVAEH
LVRAWSVRHLLLVSRQGPDAPDARDLADRLVGLGATVRIVAADLTDGRATADLVASVDPA
HPLTGVIHAAGVLDDAVVTAQTSDQLARVWAAKASVAANLDAATSELPLGLFLMFSSAAG
VLGNAGQAGYAAANAFVDALVGRRRATGLPGLSIAWGLWARGSAMTRHLDDADLARLRAG
GVKPLLDEQGLALLDAARATAAHTSLVVAAGIDVRGLNRDDVPAILRDLAGRTRRRAAAD
STVDQAALERRLTGLDEAERRAVVTDVVRECVAAVLGHRSAADVRTEANFKDLGFDSLTA
VQLRNRLSAASGLRLPATLAFDHPTPQALAAYLGTRLSGRTATPVAPVAPSAAATDEPVA
IVAMACKYPGGATSPEGLWDLVAEGVDAVGAFPTGRGWDLERLFHPDPDHPGTSYADEGA
FLPDAGDFDAAFFGINPREALAMDPQQRLLLEASWEVLERAGIDPTTLKGTPTGTYVGVM
YHDYAAGLAQDAQLEGYSMLAGSGSVVSGRVAYTLGLEGPAVTVDTACSSSLVSIHLAAQ
ALRQGECTLALAGGVTVMATPEVFTGFSRQRGLAPDGRCKPFAAAADGTGWGEGVGVLLL
ERLSDARRHGRRVLGVVRGSAVNQDGASNGLTAPNGPSQERVIRQALASGGLSSVDVDVV
EGHGTGTTLGDPIEAQALLATYGQGRPVDRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAM
RHGVVPASLHVDVPSPHVEWDSGAVRLAVESVPWPEVEGRPRRAGVSSFGASGTNAHVIV
ESVPDGLGEDSVSVSGEAPETETDGRLVPWVVSARSPQALRDQALRLRDAVAADSTVSVQ
DVGWSLLKTRALFEQRAVVVGRERAELLSGLAVLAAGEEHPAVTRSREDGVAASGAVVWL
FSGQGSQLVGMGAGLYERFPVFAAAFDEVCGLLEGPLGVEAGGLREVVFRGPRERLDHTM
WAQAGLFALQVGLARLWESVGVRPDVVLGHSIGEIAAAHVAGVFDLADACRVVGARARLM
GGLPEGGAMCAVQATPAELAADVDDSGVSVAAVNTPDSTVISGPSGEVDRIAGVWRERGR
KTKALSVSHAFHSALMEPMLAEFTEAIREVKFTRPKVSLISNVSGLEAGEEIASPEYWAR
HVRQTVLFQPGIAQVASTAGVFVELGPGPVLTTAAQHTLDDVTDRHGPEPVLVSSLAGER
PEESAFVEAMARLHTAGVAVDWSVLFAGDRVPGLVELPTYAFQRERFWLSGRSGGGDAAT
LGLVAAGHPLLGAAVEFADRGGCLLTGRLSRSGVSWLADHVVAGAVLVPGAALVEWALRA
GDEVGCVTVEELMLQAPLVVPEASGLRVQVVVEEAGEDGRRGVQIYSRPDADAVSGDDSW
ICHATGTLTPQHTDAPNDGLAGAWPAAGAVPVDLAGFYERVADAGYAYGPGFQGLRAVWR
HGQDLLAEVVLPEAAGAHDGYGIHPALLDATLHPALLLDWPGEVQDDDGKVWLPFTWNQV
SLRAAGAATVRVRLSPGEHDEAEREVQVLVADATGTDVLSVGSVTLRPADIRQLQAVPGH
DDGLFSVDWTPLPLSRTDVSQTDADGDADWVVLSDGVGSLADVVSAAGGEAPWAVVAPVG
ASAGGGLAGFDRREGLDGRLVVERVLSLVQEFLAAPELAESRLLVLTRGAVATGGDGDGD
VDASAAAVWGLVRSAQSENPGRFILLDVDMDVDVDVDMDVDVDVDVDVDVDGDGNGSDLD
PDLNGRRLPHATLRHAAEELDEPQLALRDGQLLVPRLVRATGGGLVVAPTDRAWRLDKGS
AETLESVAPVAYPGVMEPLGPGQVRLGIHAAGINFRDVLVSLGMVPGQVGLGGEGAGVVT
ETGPDVTHLSVGDRVMGVLHGSFGPTAVADTRMVAPVPQGWDMRQAAAMPVAYLTAWYGL
VELAGLKAGERVLIHAATGGVGMAAVQIARHLGAEVFATASAAKHVVLEEMGIDAAHRAS
SRDLAFEDTFRQATDGRGMDVVLNSLTGEFIDASLRLLGDGGRFLEMGKTDVRTPEEVAA
EYPGVTYTVYDLVTDAGPDRIAVMMSELGERFASGALDPLPVRSWPLDKAREAFRFMSQA
KHTGKLVLDVPAPLDPDGTVLITGGTGALGQVVAEHLVREWGVRHLLLASRRGLDAPGSG
ELADRLSDLGAEVTVAAADVSDPASVVELVGKTDPSHPLTGVVHAAGVLEDGIVTAQTPE
GLARVWAAKAAAAANLHEATREMRLGLFVVFSSAAATLGSPGQANYAAANAYCDALMQRR
RAAGQVGLSVGWGLWEAPDAKPGVAADAKPDVAADAKTGVAADGTPQGMTGTLSGTDVAR
MARIGVKAMTSAHGLALLDAAHRHGRPHLVAVDLDTRVLAHKPAPALPALLRAFAGDQGG
QGGGRGGGRGGGPARPAAATTRQNVDWAAKLSVLTAEEQHRTLLDLVRTHAAAVLGHAGT
DAVRADAAFQDLGFDSLTAVELRNRLSASTGLRLPATFIFRHPTPSAIADELRAQLAPAG
ADPAAPLFGELDKLETVITGHAHDESTRTRLAARLQNLLWRLDDTSARSDHAAGASDADG
DAVENRDLESASDDELFELIDRELPS
selected fasta
>polyketide synthase [monensin polyketide synthase modules 7 and 8]
ATGGCGAGTGAAGAGGAACTGGTCGACTACCTCAAGCGGGTCGCCGCCGAACTGCACGAC
ACCCGGCAGCGCCTGCGCGAGGTCGAGGACCGGCGGCAGGAGCCGGTGGCCGTCGTCGGC
ATGGCCTGCCGTTTCCCCGGCGGCATCGAGACGCCCGAGGGACTGTGGGAGCTGGTCGCG
GCCGGCGACGACGCCATTGAGCCCTTCCCCACCGACCGGGGCTGGGACCTGGAAGGCATC
TACCACCCGGACCCCGACCACCCGGGTACCTGCTACGTCCGGGAGGGCGGGTTCCTAGCC
GCCCCTGACCGGTTCGACTCCGACTTCTTCGGCTTCAGCCCGCGCGAGGCCCTGGCCAGC
AGCCCGCAACTGCGACTGCTCCTGGAGACGTCCTGGGAGGCCCTCGAACGGGCGGGCATC
AACCCCGCCTCGCTCAAGGGCAGCCCCACCGGCGTCTACGTCGGCGCCGCGACCACCGGC
AACCAGACGCAGGGCGACCCCGGCGGCAAGGCGACCGAGGGTTACGCGGGCACCGCGCCC
AGCGTCCTCTCGGGCCGCCTCTCGTTCACGCTCGGCCTGGAGGGCCCGGCGGTGACCGTC
GAGACAGCGTGCTCCTCCTCGCTGGTGGCGATGCACCTGGCGGCCAACGCCCTGCGCCAG
GGCGAGTGCGACCTCGCCCTCGCGGGCGGCGTCACCGTCATGTCCACCCCCGAGGTGTTC
ACAGGCTTCTCGCGTCAGCGGGGACTGGCCCCCGACGGCCGCTGCAAGCCGTTCGCCGCC
GCGGCCGACGGCACGGGCTGGGGCGAGGGCGCGGGCCTGATCCTCCTGGAGCGCCTCTCC
GACGCCCGCAGGAAGGGCCACAAGGTCCTCGCGGTGATCCGGGGCTCGGCGATCAACCAG
GACGGCGCGAGCAACGGCTTCACCGCGCCCAACGGCCCCTCGCAGCGCCGCGTCATCCGC
CAGGCACTCTCCAGCGCCCACCTCTCCACGTCGGAGATCGACGTCGTCGAGGCGCACGGC
ACCGGCACCAGGCTCGGCGACCCCATCGAGGCCGAGGCGCTCATCGCCACCTACGGCAAG
GAGCGCGAGGACGACCGTCCCCTGTGGCTCGGCTCGGTCAAGTCCAACATCGGCCACACG
CAGGCCGCCGCGGGCGTCGCCGGAGTCATCAAGATGGTGATGGCGCTACAGCGCGAACTG
CTTCCCGCCACCCTGAACGTCGACGAGCCGACCCCGCACGTCCAGTGGGAGGGCGGCGGC
GTACGCCTCCTGACCGAACCGGTCCCGTGGTCGCGCGGCGAACGCCCGCGCCGCGCCGGA
ATCTCCTCCTTCGGCATATCGGGCACGAACGCGCACGTGGTCCTGGAGGAGGCGCCGCCG
GAGGAGGACGTGCCGGGCCCCGTGGCTGCGGAGCCGGAAGGGGTGGTGCCGTGGGTGGTC
TCCGCGCGGACCGAGGAGGCGTTGAGCGAACAGGCGCGGCGCCTGGGCGAGTTCGTGGCC
GACACGGACCCGTCGACCGCTGACGTCGGGTGGTCACTGACCACGAGCAGGGCGATCCTT
GAACACCGCGCTGTGGTGGTGGGGCGTGATCGGGATGCGCTGACGGCCGGCCTGGCGGCG
TTGGCCGCGGGTGAGGAGTCGGCGGATGTGGTGGCTGGGGTGGCCGGTGATGTGGGTCCT
GGGCCGGTGTTGGTGTTTCCGGGGCAGGGGTCGCAGTGGGTGGGCATGGGCGCCCAGCTC
CTTGACGAGTCGCCCGTCTTCGCGGCGCGGATCGCGGAGTGTGAGCAGGCGCTGTCGGCG
TACGTGGACTGGTCGCTGAGTGCGGTGTTGCGCGGGGATGGGAGTGAACTGTCCCGGGTC
GAGGTCGTGCAGCCGGTGTTGTGGGCGGTGATGGTCTCGCTGGCTGCCGTCTGGGCGGAT
TACGGGGTCACCCCGGCCGCTGTGATCGGGCACTCGCAGGGCGAGATGGCCGCCGCGTGC
GTGGCGGGGGCGCTGTCTTTGGAGGATGCGGCGCGCGTCGTGGCCGTACGCAGTGACGCG
CTTCGTCAGCTGATGGGGCAGGGCGACATGGCGTCGTTGGGCGCCAGCTCGGAGCAGGCG
GCTGAGCTCATCGGTGATCGGCCGGGCGTATGCATCGCAGCGGTCAACGGGCCGTCCTCG
ACAGTCATTTCAGGACCGCCGGAGCATGTGGCAGCCGTGGTCGCGGATGCGGAGGAACGT
GGTCTGCGCGCCCGTGTCATCGATGTCGGCTATGCCTCGCACGGTCCCCAGATCGATCAG
CTCCACGACCTCCTCACCGACCGGCTCGCCGACATCCGGCCCGCGACCACGGACGTGGCC
TTCTATTCGACGGTCACCGCCGAGCGCCTGACGGACACCACGGCCCTGGATACGGATTAC
TGGGTTACCAACCTCCGCCAGCCGGTCCGTTTCGCCGACACCATCGATGCGCTTCTCGCG
GACGGCTATCGCCTGTTCATCGAGGCCAGCGCGCACCCGGTGCTGGGTCTGGGCATGGAG
GAGACCATCGAGCAGGCGGACATCCCCGCCACGGTCGTCCCCACCCTGCGCCGCGATCAC
GGTGACACCACCCAGCTCACCCGTGCCGCAGCGCACGCCTTCACCGCCGGCGCCACCGTC
GACTGGCGGCGCTGGTTCCCGGCCGACCCCACCCCCCGCACGATCGACCTGCCCACCTAC
GCCTTCCAGCGCCGCAGCTACTGGTTGCCGGTGGACGGTGTCGGAGATGTGCGGTCGGCC
GGGCTGCGGCGGGTGGAACACTCGCTGTTGCCCGCGGCGCTCGGTCTCGCCGATGGTGCG
CTCGTGCTGACCGGACGGCTCGCGGCGTCCGGTGGTGGTGGCGGTTGGCTCGCGGATCAC
GCGGTGGCGGGCACGACGCTCGTCCCCGGTGCCGCGCTGGTCGAGTGGGCGTTGCGGGCC
GCCGACGAGGCGGGCTGCCCCTCCCTTGAGGAGCTGACGCTCCAGGCACCTCTGGTGCTG
CCCGGCTCCGGGGGCCTCCAGGTCCAAGTGGTCGTGGGTCCGGCCGACGGACAGGGCGGC
CGGCGTGAGGTGCGCGTCTTCTCGCGTGTCGACTCGGACGACGAGGCAGCGGGGCAGGAC
GAGGGGTGGTCGTGTCACGCGACCGGTGTGCTGAGCCCCGAGCCCGGTGCGGTACCGGAC
GGGCTCAGCGGACAGTGGCCCCCGACGGGCGCCGAGCCGCTGGAGATCAGTGATCTCTAC
GAGCAGGCGGCATCGGCGGGATACGAGTACGGGCCGTCGTTCCGGGGCCTGCGCTCCGTG
TGGCGGCACGGGCATAACCTGCTGGCAGAGGTGGAGCTGCCCGAACAGGCAGGTGCGCAC
GACGACTTCGGCATCCACCCCGTACTGCTGGACGCCGCGCTGCACCCGGCGCTGCTGCTC
GACCAGAACGCGCCCGGCGAAGAGCAAGAGCCAGCCCAGCCCGCTCTTCGCCTGCCGTTC
GTGTGGAACGGCGTCTCCCTGTGGGCCACCGGCGCCGCGACCGTGCGGGTACGGCTGGCC
CCGCACGGGGGAGGGGAGACGGACGATAGCGCCGGGCTGCGCGTGACGGTCGCCGACGCC
ACCGGAGCACCGGTGCTGAGCGTGGACTCCCTCGCTCTGCGCCCCGCTGACCCCGAACTG
CTGCGCACGGCCGGTCGGGCGGGCAGCGGCACCAACGGCTTGTTCACGGTGGAGTGGACC
GCTCTGCCCCCGGCGGACGTGGCCGACCACGCCGCAGGCGACGGCTGGGCGGTGCTCGGT
CAGGACGTACCCGACTGGGCCGGAGCGGACATGCCCCGGCATCCCGACATGGCCTCCCTG
TCGGCCGCGCTGGACGAGGGAACGCAGGCCCCTGCGGCCGTCTTCGTGGAGACCACAGCC
ACATCGCACGCCACACCGAACACCGCAGCGGACGTGACGCTCGACGCGTCCGGCCGGGCG
GTCGCCGAGCGCACCCTGCACCTGCTGCGGGACTGGCTCGCCGAACCGCGCCTCGCCGAG
ACCCGGCTCGTCCTCATCACCCACCACGCGGTGACGACCCCGGCGGACGACGACGTGAAC
GCCGCACCCCTCGACGTCCCGGCCGCCGCCCTGTGGGGACTGATCCGCAGCGCACAGGCC
GAACACCCGGACCGCTTCGTTCTGTTGGACACCGACGCGAAGGCCAACACCGACCCCGGC
CCCGACACCAGTACTGACCACAGCACCGCATCGGGTACGTACCGAACCGTCATCGCGCGG
GCCCTCGCCACCGGGGAGCCACAGCTGGCCGTGCGCGCGGGAGAACTGCTGGCTCCCCGC
CTCGCCCGAGCCGCCACCCCCACACCCGAGACCCCCACACCCGAGACACAGCCCGACACC
GGATCCGGGTCCGAGGCCGGGGCCGGGTCCGGATCTGGACCCGGCGCGACACTGGACCCC
GACGGCACCGTCCTCATCGCGGGCGGCACCGGCATGATGGGTGGTCTCGTCGCCGAACAC
CTGGTCCGCGCCTGGTCGGTGCGGCACCTCCTGCTCGTCAGCCGGCAAGGGCCCGACGCG
CCGGACGCCCGCGACCTCGCCGACCGGCTGGTCGGCCTGGGCGCGACGGTACGGATCGTC
GCGGCCGACCTGACGGACGGGCGGGCCACCGCGGACCTCGTCGCGTCGGTCGACCCGGCG
CACCCGCTCACCGGTGTGATCCACGCGGCCGGCGTCCTGGACGACGCCGTGGTCACCGCG
CAGACCTCCGACCAGCTGGCCAGGGTGTGGGCGGCCAAGGCGTCCGTCGCCGCCAACCTG
GACGCGGCCACGTCGGAGCTGCCGCTCGGCTTGTTCCTGATGTTCTCGTCCGCCGCCGGT
GTCCTCGGCAACGCGGGCCAGGCCGGTTACGCGGCCGCCAACGCCTTCGTCGACGCCCTG
GTCGGCCGCCGTCGCGCCACCGGCCTGCCCGGCCTGTCGATCGCCTGGGGCCTGTGGGCG
CGCGGCAGCGCCATGACCCGGCACCTGGACGACGCCGACCTCGCGCGGCTGCGTGCCGGC
GGGGTCAAGCCCCTGCTGGACGAGCAGGGCCTCGCCCTCCTCGACGCGGCGCGCGCCACC
GCCGCGCACACCTCGCTGGTGGTCGCGGCCGGTATCGACGTACGCGGACTGAACAGGGAC
GACGTCCCCGCGATCCTCCGCGACCTGGCGGGCCGGACCCGCCGCAGGGCGGCCGCCGAC
TCCACCGTCGACCAGGCCGCGCTGGAGCGGCGCCTCACGGGCCTGGACGAGGCCGAGCGC
CGGGCTGTCGTCACCGACGTCGTACGCGAATGCGTGGCGGCCGTGCTCGGCCACCGGTCG
GCGGCCGACGTACGCACCGAGGCCAACTTCAAGGACCTCGGCTTCGACTCGCTCACTGCG
GTGCAGCTGCGCAACCGCCTCTCGGCGGCGAGCGGCCTCCGCCTGCCCGCCACCCTGGCC
TTCGACCACCCCACCCCCCAGGCGCTGGCGGCGTACCTCGGCACGCGCCTGAGCGGCCGG
ACCGCCACCCCCGTCGCACCCGTGGCGCCTTCCGCGGCCGCGACGGACGAGCCGGTGGCG
ATCGTCGCGATGGCCTGCAAGTACCCGGGTGGAGCGACCTCGCCGGAAGGCCTCTGGGAC
CTGGTCGCGGAGGGCGTGGACGCGGTCGGCGCCTTCCCGACGGGCCGCGGCTGGGACCTC
GAACGGCTCTTCCACCCCGACCCGGACCACCCCGGCACGAGTTACGCCGACGAAGGGGCC
TTCCTTCCTGACGCGGGCGATTTCGATGCGGCGTTCTTCGGGATCAATCCGCGGGAGGCG
CTGGCGATGGATCCGCAGCAGCGGCTGTTGCTGGAGGCGTCGTGGGAGGTGTTGGAGCGT
GCGGGTATCGACCCGACGACGCTCAAGGGCACCCCGACCGGCACGTACGTCGGCGTGATG
TACCACGACTACGCGGCAGGCCTCGCCCAGGACGCCCAACTGGAGGGCTACTCCATGCTC
GCCGGCTCCGGCAGCGTGGTGTCCGGCCGCGTCGCCTACACCCTGGGGCTTGAGGGTCCT
GCGGTGACGGTCGACACCGCGTGCTCCTCGTCCCTGGTCTCCATCCACCTGGCCGCGCAA
GCACTGCGACAGGGCGAGTGCACTCTCGCCCTCGCGGGCGGCGTGACCGTCATGGCCACG
CCCGAGGTGTTCACCGGATTCTCGCGCCAGCGCGGCCTGGCCCCCGACGGCCGCTGCAAG
CCGTTCGCCGCCGCCGCCGACGGCACCGGCTGGGGCGAGGGTGTCGGTGTGTTGTTGCTC
GAGCGGTTGTCGGATGCGCGGCGTCATGGGCGTCGGGTGTTGGGTGTGGTGCGGGGTTCG
GCGGTGAATCAGGACGGTGCGAGTAATGGGTTGACGGCGCCGAATGGTCCGTCGCAGGAG
CGGGTGATTCGTCAGGCGTTGGCCAGTGGTGGGTTGTCGTCGGTGGATGTTGATGTGGTG
GAGGGGCATGGGACGGGGACCACGTTGGGTGATCCGATCGAGGCGCAGGCTCTGCTGGCC
ACGTATGGGCAGGGGCGTCCGGTGGATCGTCCGTTGTGGTTGGGGTCGGTGAAGTCGAAT
ATTGGTCATACGCAGGCGGCTGCGGGTGTTGCGGGTGTCATCAAGATGGTGATGGCGATG
CGGCATGGTGTGGTGCCGGCGAGTTTGCATGTGGATGTGCCGTCGCCGCATGTGGAGTGG
GATTCGGGTGCGGTGCGGTTGGCGGTTGAGTCGGTGCCATGGCCGGAGGTGGAGGGTCGT
CCGCGTCGGGCGGGTGTGTCGTCGTTCGGGGCTTCGGGAACGAATGCGCACGTGATCGTG
GAGTCTGTGCCCGATGGGCTGGGGGAGGACTCGGTATCGGTCAGTGGTGAGGCTCCCGAG
ACTGAGACTGACGGGCGCTTGGTGCCGTGGGTGGTATCGGCCCGCAGCCCGCAGGCCCTG
CGCGACCAGGCACTACGCCTGCGTGATGCGGTGGCGGCCGACTCAACGGTGTCGGTGCAG
GATGTGGGCTGGTCGCTGCTGAAGACGCGTGCGCTGTTCGAGCAGCGGGCGGTGGTGGTG
GGGCGTGAGAGGGCTGAACTCCTGTCGGGGCTTGCTGTGTTGGCCGCTGGCGAGGAGCAC
CCGGCTGTGACGCGGTCCCGTGAGGACGGGGTTGCTGCGAGCGGTGCTGTGGTGTGGCTG
TTCAGTGGTCAGGGCAGTCAGTTGGTCGGTATGGGTGCTGGTTTGTATGAGCGGTTCCCG
GTGTTTGCGGCTGCGTTTGATGAGGTGTGCGGCCTGTTGGAGGGGCCGTTGGGCGTGGAG
GCGGGTGGGTTGCGGGAGGTGGTGTTCCGTGGCCCGAGGGAGCGGTTGGATCACACGATG
TGGGCGCAGGCGGGGTTGTTTGCGCTGCAGGTGGGGTTGGCCCGGTTGTGGGAGTCGGTC
GGGGTGCGGCCGGATGTGGTGCTCGGGCATTCGATCGGTGAGATCGCGGCCGCGCATGTG
GCGGGGGTCTTTGATCTGGCGGATGCCTGTCGGGTGGTGGGGGCGCGGGCCCGTTTGATG
GGTGGGCTGCCTGAGGGCGGGGCGATGTGCGCGGTGCAGGCCACGCCCGCCGAGCTGGCC
GCCGACGTGGACGACTCTGGTGTGAGTGTGGCGGCGGTCAACACACCTGATTCGACGGTG
ATTTCAGGGCCGTCTGGTGAGGTGGATCGGATTGCTGGGGTGTGGCGGGAGCGTGGGCGT
AAGACGAAGGCGCTGAGCGTCAGTCATGCCTTCCACTCGGCGTTGATGGAGCCGATGCTC
GCGGAGTTCACCGAAGCGATACGAGAGGTCAAGTTCACGCGGCCGAAGGTGTCGTTGATC
AGCAACGTCTCTGGTCTGGAGGCGGGTGAGGAGATCGCGTCCCCGGAGTACTGGGCACGC
CATGTACGCCAGACAGTGCTCTTCCAGCCCGGCATCGCCCAAGTGGCTTCCACGGCAGGC
GTGTTTGTCGAGCTCGGCCCCGGCCCCGTACTGACTACTGCCGCCCAGCACACCCTGGAC
GACGTAACCGATAGGCATGGCCCCGAACCGGTACTGGTGTCCTCGCTGGCCGGTGAGCGT
CCTGAGGAGTCGGCGTTCGTGGAGGCGATGGCTCGTCTGCATACCGCTGGTGTTGCTGTG
GACTGGTCGGTGTTGTTCGCGGGTGATCGTGTGCCTGGGCTGGTGGAGTTGCCGACGTAT
GCGTTCCAGCGGGAGCGGTTCTGGTTGAGCGGCCGTTCTGGGGGTGGGGATGCGGCGACT
TTGGGTCTGGTGGCGGCGGGGCATCCGTTGTTGGGTGCGGCGGTGGAGTTCGCGGACCGG
GGTGGGTGTCTGCTGACCGGTCGGCTGTCGCGGTCTGGGGTGTCGTGGCTTGCTGATCAT
GTGGTGGCGGGTGCGGTTTTGGTGCCGGGTGCTGCGTTGGTGGAGTGGGCGTTGCGGGCC
GGTGATGAGGTCGGTTGTGTGACGGTGGAGGAGTTGATGTTGCAGGCGCCTTTGGTGGTG
CCTGAGGCGTCGGGTCTGCGGGTTCAGGTGGTGGTCGAGGAGGCGGGTGAGGACGGGCGG
CGCGGTGTCCAGATCTATAGCCGGCCTGACGCGGACGCCGTGAGCGGCGACGACTCGTGG
ATCTGCCACGCGACCGGCACCCTCACCCCCCAGCACACCGACGCTCCGAACGACGGACTG
GCCGGCGCGTGGCCCGCGGCGGGCGCCGTGCCGGTGGACCTGGCGGGCTTCTACGAGCGC
GTGGCGGACGCGGGCTATGCGTACGGCCCGGGGTTCCAGGGGCTGCGTGCCGTGTGGCGG
CACGGTCAGGACCTGCTGGCCGAGGTCGTCCTGCCCGAAGCCGCGGGTGCCCATGACGGC
TACGGCATCCACCCCGCCCTCCTCGACGCCACCCTCCACCCGGCCCTGCTCCTCGACTGG
CCCGGGGAGGTGCAGGACGACGACGGGAAGGTCTGGCTGCCTTTCACCTGGAACCAGGTC
TCCTTGCGGGCTGCGGGAGCCGCCACCGTACGCGTACGTCTCTCGCCCGGCGAGCACGAC
GAGGCGGAACGGGAAGTACAGGTACTGGTGGCCGACGCCACCGGGACCGACGTCCTGAGC
GTGGGGTCGGTGACGTTGCGTCCCGCCGACATCCGGCAACTGCAGGCCGTGCCGGGTCAC
GACGACGGTCTGTTCTCGGTGGACTGGACGCCGCTGCCGCTGTCGCGGACGGATGTGTCG
CAGACGGATGCCGACGGGGATGCCGACTGGGTTGTGCTCTCGGACGGTGTCGGCAGCCTG
GCTGATGTGGTGTCGGCGGCGGGTGGTGAAGCGCCGTGGGCAGTGGTCGCTCCCGTCGGT
GCATCCGCGGGCGGCGGCCTTGCCGGCTTTGACCGCCGTGAGGGTCTTGACGGTCGGCTG
GTCGTGGAGCGGGTGTTGTCACTCGTACAGGAGTTCCTGGCCGCGCCGGAGCTGGCCGAG
TCCCGGCTCCTCGTGCTGACCCGCGGCGCCGTGGCGACCGGCGGCGACGGCGACGGTGAT
GTGGACGCGTCCGCCGCAGCCGTATGGGGCCTGGTCCGCAGTGCTCAGTCCGAGAACCCG
GGCCGCTTCATCCTGCTCGACGTGGACATGGACGTGGACGTCGACGTGGACATGGACGTG
GACGTCGACGTGGACGTCGACGTGGACGTGGACGGAGACGGCAATGGCAGCGACCTGGAC
CCGGACCTGAACGGCCGACGACTTCCCCACGCCACCCTGCGTCACGCCGCCGAGGAACTC
GACGAGCCCCAACTCGCCCTGCGCGACGGACAACTGCTCGTTCCGCGGCTGGTCCGCGCC
ACCGGCGGCGGACTCGTCGTGGCGCCCACCGACCGTGCCTGGCGCCTGGACAAGGGAAGC
GCCGAGACGCTGGAGAGCGTCGCGCCGGTCGCGTACCCCGGAGTCATGGAACCCCTGGGC
CCCGGCCAGGTCCGCCTCGGCATCCACGCCGCGGGCATCAACTTCCGCGACGTCCTGGTC
AGCCTCGGCATGGTGCCCGGCCAGGTCGGCCTGGGCGGCGAAGGCGCCGGTGTCGTGACG
GAGACAGGCCCCGATGTCACCCACCTGTCGGTCGGCGACCGCGTGATGGGCGTCCTCCAC
GGCTCCTTCGGCCCGACGGCCGTGGCGGACACCCGCATGGTCGCGCCGGTTCCGCAGGGC
TGGGACATGCGGCAGGCGGCCGCGATGCCCGTCGCGTATCTGACGGCTTGGTACGGGTTG
GTGGAGCTGGCCGGTCTGAAGGCGGGCGAGCGCGTGCTGATCCACGCAGCCACGGGTGGT
GTGGGAATGGCGGCGGTGCAGATCGCCCGTCACCTGGGTGCCGAGGTGTTCGCCACCGCC
AGTGCAGCCAAGCACGTCGTACTGGAAGAGATGGGCATCGACGCCGCCCACCGCGCCTCC
TCCCGGGACCTCGCCTTCGAGGACACCTTCCGGCAGGCCACCGACGGGCGCGGCATGGAC
GTCGTCCTCAACAGCCTGACCGGCGAGTTCATCGACGCATCTCTGCGGTTGCTCGGCGAC
GGCGGCCGGTTCCTGGAGATGGGCAAGACCGATGTGCGCACGCCGGAGGAGGTGGCCGCG
GAGTACCCGGGTGTCACCTACACCGTGTACGACCTCGTCACCGACGCGGGGCCGGATCGC
ATCGCGGTCATGATGAGTGAGCTGGGCGAGAGGTTCGCTTCCGGTGCCCTTGACCCTCTG
CCGGTGCGTTCCTGGCCGCTGGACAAGGCGCGTGAGGCGTTCCGGTTCATGAGTCAGGCC
AAGCACACCGGCAAACTCGTACTCGACGTGCCCGCACCGCTCGACCCCGACGGGACCGTC
CTGATCACCGGAGGCACGGGGGCGCTGGGGCAGGTCGTGGCCGAGCATCTGGTGCGGGAG
TGGGGCGTACGGCACCTGCTGCTGGCCAGCCGCCGTGGACTGGACGCCCCCGGCAGCGGT
GAACTCGCCGACAGGCTGTCGGACTTGGGCGCCGAGGTGACCGTCGCGGCGGCCGATGTG
AGCGACCCGGCCTCGGTGGTGGAGCTGGTCGGCAAGACGGATCCCTCGCATCCGTTGACG
GGTGTCGTGCACGCGGCGGGCGTGCTTGAGGACGGGATCGTGACGGCTCAGACGCCTGAG
GGGCTGGCGCGGGTGTGGGCGGCCAAGGCCGCTGCGGCGGCGAATCTCCATGAGGCGACC
CGGGAGATGCGTCTCGGTCTGTTCGTGGTGTTCTCCTCGGCGGCCGCCACGCTCGGCAGT
CCGGGCCAGGCCAACTACGCGGCTGCCAATGCCTATTGTGACGCGCTGATGCAGCGCCGA
CGGGCGGCGGGCCAGGTCGGCCTGTCGGTCGGCTGGGGTCTCTGGGAGGCACCGGACGCC
AAGCCGGGTGTTGCCGCCGACGCCAAACCGGATGTTGCCGCCGACGCCAAGACGGGAGTT
GCCGCCGACGGCACTCCCCAGGGCATGACCGGCACCCTGAGCGGCACCGACGTGGCCCGC
ATGGCACGCATCGGCGTCAAGGCGATGACCAGCGCACACGGTCTCGCCCTGCTCGACGCC
GCACACCGCCACGGCCGCCCCCACCTCGTCGCCGTCGACCTCGACACCCGCGTCCTGGCG
CACAAACCCGCCCCGGCCCTCCCCGCCCTCCTGCGCGCCTTCGCCGGAGACCAGGGAGGC
CAGGGAGGCGGCCGAGGCGGCGGTCGGGGCGGCGGCCCGGCACGACCGGCGGCCGCCACC
ACCCGGCAGAACGTCGACTGGGCCGCGAAGCTCTCCGTCCTGACAGCCGAGGAACAGCAC
CGCACCCTCCTCGACCTGGTACGGACGCACGCGGCAGCCGTCCTCGGGCACGCGGGCACC
GACGCCGTACGCGCCGACGCCGCCTTCCAGGATCTCGGCTTCGACTCCCTCACCGCGGTC
GAACTGCGCAACCGCCTCTCCGCCTCCACCGGCCTGCGCCTGCCCGCCACGTTCATCTTC
CGGCACCCGACCCCGTCGGCCATCGCCGACGAACTGCGCGCACAGCTGGCCCCCGCGGGG
GCCGACCCGGCCGCGCCGCTCTTCGGTGAACTGGACAAGCTGGAGACGGTGATCACGGGG
CACGCGCACGACGAGAGCACCCGGACCCGCCTGGCGGCACGCCTGCAGAACCTGCTGTGG
CGCCTGGACGACACTTCGGCCCGCTCGGACCACGCGGCCGGCGCGAGCGACGCCGACGGC
GACGCCGTCGAGAACCGAGACCTCGAGTCCGCGTCGGACGACGAGCTCTTCGAGCTGATC
GACCGAGAACTGCCTTCTTGA
[7] KS34..408
[7] AT563..879
[7] methylmalonyl-CoA751..755
[7] DH927..1097
[7] KR1482..1662
[7] ACP1764..1834
[8] KS1856..2232
[8] AT2398..2720
[8] malonyl-CoA2589..2593
[8] DH2768..2935
[8] ER3302..3608
[8] KR3618..3798
[8] ACP3943..4013
[7] KS100..1224
[7] AT1687..2637
[7] methylmalonyl-CoA2251..2265
[7] DH2779..3291
[7] KR4444..4986
[7] ACP5290..5502
[8] KS5566..6696
[8] AT7192..8160
[8] malonyl-CoA7765..7779
[8] DH8302..8805
[8] ER9904..10824
[8] KR10852..11394
[8] ACP11827..12039

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [560-684]  G3DSA:3.40.366.10 [751-869]  G3DSA:3.40.366.10 [2397-2520]  G3DSA:3.40.366.10 [2588-2687]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1482-1649]  1.6e-49 PF00106 [3618-3784]  1.09999999999999e-55 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1792-1807]  PS00012 [3971-3986]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1757-1873]  5.20000089003336e-29 SSF47336 [3935-4030]  5.29999657550189e-24 SSF47336
SSF47336   ACP_like
 [1764-1838]  5.40000000000002e-47 G3DSA:1.10.1200.10 [3941-4017]  5.40000000000002e-47 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1767-1833]  3.4e-14 PF00550 [3946-4012]  6.3e-12 PF00550
PF00550   PP-binding
 [1764-1834]  PS50075 [3943-4013]  PS50075
PS50075   ACP_DOMAIN
IPR011032 GroES-like (Domain)
 [3316-3447]  6.09999977126211e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [3440-3533]  4.5e-18 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [3321-3377]  6.4e-07 PF08240
PF08240   ADH_N
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-282]  1.39999999999997e-92 PF00109 [1856-2106]  5.00000000000001e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [290-408]  1.2e-46 PF02801 [2114-2232]  8.89999999999994e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [563-879]  2.50000000000001e-103 PF00698 [2398-2720]  2.99999999999998e-64 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-34]  6.09999977126211e-06 SSF101173
SSF101173   Polyketide_synth_docking
 [1-27]  2.5e-12 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [561-863]  3.80000697093588e-62 SSF52151 [2396-2686]  1.20000117458134e-64 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [686-750]  2.09999806691534e-16 SSF55048 [2525-2588]  1.39999892049878e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-293]  G3DSA:3.40.47.10 [294-461]  8.20000000000025e-129 G3DSA:3.40.47.10 [1856-2117]  G3DSA:3.40.47.10 [2118-2284]  8.20000000000025e-129 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-396]  1.69998802370953e-102 SSF53901 [1849-2285]  1e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1482-1668]  3.99999999999998e-57 G3DSA:3.40.50.720 [3392-3582]  1.5e-53 G3DSA:3.40.50.720 [3618-3798]  3.99999999999998e-57 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [195-211]  PS00606 [2019-2035]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [565-860]  1.50000965748778e-113 SM00827 [2400-2699]  1.69998802370953e-105 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1765-1837]  3.10001307370206e-34 SM00823 [3944-4016]  2.30000440726534e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [927-1097]  9.69997533354407e-73 SM00826 [2768-2935]  1.79999754022378e-80 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-460]  SM00825 [1859-2285]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1482-1662]  9.49996855930963e-46 SM00822 [3618-3798]  3.59998852907783e-56 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [3302-3608]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit