close all open/close all

CDS information : Monen_00200


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction66,952 / 72,054 / + [in whole cluster]
66,952 / 72,054 / + [in contig]
Location66952..72054 [in whole cluster]
66952..72054 [in contig]
TypeCDS
Length5,103 bp (1,700 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)monensin polyketide synthase module 9
Gene
Gene (GenBank)monAVI
EC number
Keyword
Note
Note (GenBank)
  • MonAVI
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionPKS/NRPS Module

9 malonyl-CoA
KS41..416
AT582..903
dh
KR1264..1433
ACP1541..1611

close this sectionSequence

selected fasta
>polyketide synthase [monensin polyketide synthase module 9]
MPGTNDMPGTEDKLRHYLKRVTADLGQTRQRLRDVEERQREPIAIVAMACRYPGGVASPE
QLWDLVASRGDAIEEFPADRGWDVAGLYHPDPDHPGTTYVREAGFLRDAARFDADFFGIN
PREALAADPQQRVLLEVSWELFERAGIDPATLKDTLTGVYAGVSSQDHMSGSRVPPEVEG
YATTGTLSSVISGRIAYTFGLEGPAVTLDTACSASLVAIHLACQALRQGDCGLAVAGGVT
VLSTPTAFVEFSRQRGLAPDGRCKPFAEAADGTGFSEGVGLILLERLSDARRNGHQVLGV
VRGSAVNQDGASNGLTAPNDVAQERVIRQALTNARVTPDAVDAVEAHGTGTTLGDPIEGN
ALLATYGKDRPADRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGELPASLHIDRPTP
HVDWEGGGVRLLTDPVPWPRADRPRRAGVSSFGISGTNAHLIVEQAPAPPDTADDAPEGA
ATPGASDGLVVPWVVSARSPQALRDQALRLRDFAGDASRAPLTDVGWSLLRSRALFEQRA
VVAGRERAELLAGLAALAAGEEHPAVTRSREEAAVAASGDVVWLFSGQGSQLVGMGAGLY
ERFPVFAAAFDEVCGLLEGELGVGSGGLREVVFWGPRERLDHTVWAQAGLFALQVGLARL
WESVGVRPDVVLGHSIGEIAAAHVAGVFDLADACRVVGARARLMGGLPEGGAMCAVQATP
AELAADVDGSSVSVAAVNTPDSTVISGPSGEVDRIAGVWRERGRKTKALSVSHAFHSALM
EPMLGEFTEAIRGVKFRQPSIPLMSNVSGERAGEEITSPEYWARHVRQTVLFQPGVAQVA
AEARAFVELGPGPVLTAAAQHTLDHITEPEGPEPVVTASLHPDRPDDVAFAHAMADLHVA
GISVDWSAYFPDDPAPRTVDLPTYAFQGRRFWLADIAAPEAVSSTDGEEAGFWAAVEGAD
FQALCDTLHLKDDEHRAALETVFPALSAWRRERRERSIVDAWRYRVDWRRVELPTPVPGA
GTGPDADTGLGAWLIVAPTHGSGTWPQACARALEEAGAPVRIVEAGPHADRADMADLVQA
WRASCADDTTQLGGVLSLLALAEAPATSSDTTSHTSTSCGTGSLASHGLTGTLTLLHGLL
DAGVEAPLWCATRGAVSCGDADPLVSPSQAPVWGLGRVAALEHPELWGGLVDLPADPESL
DASALYAVLRGDGGEDQVALRRGAVLGRRLVPDATPDVAPGSSPDVSGGAAHADATSGEW
QPHGAVLVTGGVGHLADQVVRWLAASGAEHVVLLDTGPANSRGPGRNDDLAAEAAEHGTE
LTVLRSLSELTDVSVRPIRTVIHTSLPGELAPLAEVTPDALGAAVSAAARLSELPGIGSV
ETVLFFSSVTASLGSREHGAYAAANAYLDALAQRAGADAASPRTVSVGWGIWDLPDDGDV
ARGAAGLSRRQGLPPLEPQLALGALRAALDGGKGHTLVADIEWERFAPLFTLARPTRLLD
GIPAAQRVLDASSESAEASENASALRRELTALPVRERTGALLDLVRKQVAAVLRYEPGQD
VAPEKAFKDLGFDSLVVVELRNRLRAATGLRLPATLVYDYPTPRTLAAHLLDRVLPDGGA
AELPVAAHLDDLEAALTDLPADDPRRKGLVRRLQTLLWKQPDAMGAAGPADEEEQAAPED
LSTASADDMFALIDREWGTR
selected fasta
>polyketide synthase [monensin polyketide synthase module 9]
ATGCCGGGTACGAACGACATGCCGGGTACCGAGGACAAGCTCCGCCACTACCTGAAGCGA
GTGACCGCGGATCTCGGACAGACCCGTCAGCGCCTGCGCGACGTGGAGGAGCGCCAGCGG
GAACCGATCGCCATCGTCGCGATGGCCTGCCGCTACCCGGGCGGGGTGGCCTCCCCCGAG
CAGCTGTGGGACCTGGTCGCCTCACGCGGCGACGCCATCGAGGAGTTCCCCGCCGACCGC
GGCTGGGACGTGGCGGGCCTCTACCACCCCGACCCGGACCACCCCGGCACGACCTATGTA
CGAGAGGCCGGATTCCTGCGGGACGCCGCCCGCTTCGACGCCGACTTCTTCGGCATCAAC
CCGCGCGAGGCGCTCGCCGCCGACCCGCAGCAACGGGTGCTCCTCGAAGTGTCGTGGGAA
CTGTTCGAGCGGGCGGGCATCGACCCCGCCACGCTCAAGGACACCCTCACCGGCGTGTAC
GCGGGGGTGTCCAGCCAGGACCACATGTCCGGGAGCCGGGTCCCGCCGGAGGTCGAGGGC
TACGCCACCACGGGAACCCTCTCCAGCGTCATCTCCGGCCGCATCGCCTACACCTTCGGC
CTGGAGGGCCCGGCGGTGACGCTCGACACGGCGTGCTCGGCATCGCTGGTCGCGATCCAC
CTCGCCTGCCAGGCCCTGCGCCAGGGCGACTGCGGCCTGGCGGTGGCGGGAGGCGTGACC
GTACTGTCCACGCCGACGGCGTTCGTGGAGTTCTCACGCCAGCGCGGACTCGCACCGGAC
GGCCGCTGCAAGCCGTTCGCCGAGGCCGCCGACGGCACCGGATTCTCCGAGGGCGTCGGC
CTGATCCTCCTGGAACGCCTCTCCGACGCCCGCCGCAACGGACATCAAGTACTCGGCGTC
GTACGCGGATCGGCCGTCAACCAGGACGGCGCGAGCAACGGCCTGACCGCCCCGAACGAC
GTCGCCCAGGAACGCGTGATCCGCCAGGCCCTGACCAACGCCCGCGTCACCCCGGACGCC
GTCGACGCCGTGGAGGCACACGGCACCGGCACCACGCTCGGCGACCCGATCGAGGGGAAC
GCACTCCTCGCGACGTACGGAAAGGACCGCCCCGCCGACCGGCCGCTGTGGCTCGGCTCT
GTGAAGTCGAACATCGGCCACACGCAGGCGGCTGCGGGCGTCGCAGGCGTCATCAAGATG
GTGATGGCGATGCGCCACGGCGAGCTGCCCGCCTCCCTGCACATCGACCGGCCCACGCCC
CACGTGGACTGGGAGGGCGGGGGAGTGCGGTTGCTCACCGATCCCGTGCCGTGGCCACGG
GCCGACCGCCCCCGCCGCGCGGGGGTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCAC
CTGATCGTGGAACAGGCCCCCGCCCCGCCCGACACGGCCGACGACGCCCCGGAAGGCGCC
GCAACCCCCGGCGCTTCCGACGGCCTCGTGGTGCCGTGGGTGGTGTCGGCCCGTAGTCCG
CAGGCCCTGCGTGATCAGGCCCTGCGTCTGCGCGACTTTGCCGGTGACGCGTCCCGAGCG
CCGCTCACCGACGTGGGCTGGTCTTTGCTGCGGTCGCGTGCGCTGTTCGAGCAGCGGGCG
GTGGTGGCGGGGCGTGAGAGGGCTGAACTGCTGGCGGGGCTGGCTGCGTTGGCCGCTGGT
GAGGAGCACCCGGCTGTGACGCGGTCCCGTGAGGAAGCGGCGGTTGCTGCGAGCGGTGAT
GTGGTGTGGCTGTTCAGTGGTCAGGGCAGTCAGTTGGTCGGTATGGGTGCTGGTTTGTAT
GAGCGGTTCCCGGTGTTTGCGGCTGCGTTTGATGAGGTGTGCGGCTTGCTGGAGGGGGAG
CTGGGGGTTGGTTCGGGTGGGTTGCGGGAGGTGGTGTTCTGGGGCCCGCGGGAGCGGTTG
GATCACACGGTGTGGGCGCAGGCGGGGTTGTTTGCGTTGCAGGTGGGGTTGGCCCGGTTG
TGGGAGTCGGTCGGGGTGCGGCCGGATGTGGTGCTCGGGCATTCGATCGGTGAGATCGCG
GCCGCGCATGTGGCGGGGGTCTTTGATCTGGCGGATGCGTGTCGGGTGGTGGGGGCGCGG
GCGCGTTTGATGGGTGGGTTGCCTGAGGGTGGGGCGATGTGTGCGGTGCAGGCCACGCCC
GCCGAGCTGGCCGCGGATGTGGATGGCTCGTCCGTGAGTGTGGCGGCGGTCAACACACCT
GACTCGACGGTGATTTCAGGTCCGTCGGGTGAGGTGGATCGGATTGCTGGGGTGTGGCGG
GAGCGTGGGCGTAAGACGAAGGCGCTGAGCGTGAGTCATGCTTTCCATTCGGCGTTGATG
GAGCCGATGCTCGGGGAGTTCACGGAAGCGATACGAGGGGTCAAGTTCAGGCAGCCGTCG
ATCCCGCTCATGAGCAATGTCTCCGGAGAGCGGGCCGGCGAGGAGATCACATCCCCGGAG
TACTGGGCGAGGCATGTACGCCAGACAGTGCTCTTCCAGCCCGGCGTCGCCCAAGTGGCC
GCTGAGGCACGCGCGTTCGTCGAACTCGGCCCCGGCCCCGTACTGACCGCCGCCGCCCAG
CACACCCTCGACCACATCACCGAGCCGGAAGGCCCCGAGCCGGTCGTCACCGCGTCCCTC
CACCCCGACCGGCCGGACGACGTGGCCTTCGCGCACGCCATGGCCGACCTCCACGTCGCC
GGTATCAGCGTGGACTGGTCGGCGTACTTCCCTGACGACCCCGCCCCCCGCACCGTCGAC
CTGCCCACCTACGCCTTCCAGGGGCGGCGCTTCTGGCTGGCGGACATCGCGGCGCCCGAG
GCCGTGTCCTCGACGGACGGTGAGGAGGCCGGGTTCTGGGCCGCCGTCGAAGGTGCGGAC
TTCCAGGCGCTCTGCGACACCCTGCACCTCAAGGACGACGAGCACCGCGCGGCTCTGGAG
ACGGTGTTCCCCGCGCTGTCCGCGTGGCGGCGCGAACGACGTGAGCGGTCGATCGTCGAT
GCCTGGCGGTACCGGGTCGACTGGCGGCGCGTCGAGCTGCCGACACCCGTTCCGGGCGCC
GGTACCGGTCCCGACGCCGACACGGGCCTCGGGGCGTGGCTGATCGTGGCTCCCACGCAC
GGGTCGGGTACTTGGCCGCAAGCCTGTGCCCGGGCGTTGGAGGAGGCGGGCGCGCCGGTA
CGTATCGTCGAGGCCGGCCCGCACGCCGACCGGGCGGACATGGCGGACCTGGTCCAGGCA
TGGCGGGCAAGCTGTGCGGACGACACCACCCAGCTCGGAGGAGTGCTCTCCCTGCTGGCT
CTCGCCGAGGCACCGGCCACCAGTTCCGACACCACTTCCCACACCAGTACCAGTTGCGGT
ACCGGCTCTCTCGCGTCCCACGGCCTCACCGGCACCTTGACGCTGCTGCACGGTCTGCTG
GATGCGGGCGTCGAAGCGCCTCTCTGGTGTGCCACGCGCGGCGCCGTGTCGTGCGGCGAC
GCCGATCCGCTCGTCTCCCCGTCGCAGGCCCCGGTCTGGGGACTCGGACGCGTGGCCGCC
CTGGAGCATCCGGAGTTGTGGGGCGGCCTGGTCGACCTGCCCGCCGACCCGGAGTCGCTC
GACGCGAGCGCGTTGTATGCGGTTCTGCGCGGAGACGGCGGCGAGGATCAGGTCGCGCTG
CGCCGGGGCGCGGTCCTCGGCCGTCGCCTGGTGCCCGACGCAACCCCGGACGTGGCCCCC
GGCTCGTCCCCGGACGTGTCCGGAGGCGCAGCCCATGCCGACGCGACCTCCGGGGAGTGG
CAGCCGCATGGTGCCGTCCTCGTCACCGGAGGCGTCGGCCACCTGGCCGATCAGGTCGTA
CGGTGGCTCGCCGCGTCCGGCGCCGAACACGTCGTACTCCTGGACACGGGCCCCGCCAAC
AGCCGTGGTCCCGGCCGGAACGACGACCTCGCCGCGGAAGCCGCCGAACACGGCACCGAG
CTGACGGTCCTGCGGTCCCTGAGCGAGCTGACAGACGTATCCGTACGTCCCATACGGACC
GTCATCCACACATCGCTGCCCGGCGAGCTCGCGCCGCTGGCCGAGGTCACCCCCGACGCG
CTCGGCGCGGCCGTGTCCGCCGCCGCGCGGCTGAGCGAACTCCCCGGCATCGGGTCAGTG
GAGACCGTGCTGTTCTTCTCCTCCGTGACGGCTTCGCTCGGCAGTAGGGAGCACGGCGCG
TACGCCGCCGCCAACGCCTACCTCGACGCCCTGGCGCAACGGGCCGGTGCCGATGCTGCG
AGCCCCCGGACGGTCTCGGTCGGGTGGGGCATCTGGGATCTGCCGGACGACGGTGACGTG
GCACGCGGCGCCGCCGGGCTGTCCCGGAGGCAGGGACTCCCGCCGCTGGAACCGCAGTTG
GCGCTCGGCGCCCTGCGCGCGGCGCTCGACGGGGGCAAGGGGCACACGCTGGTCGCCGAC
ATCGAGTGGGAGCGGTTCGCGCCGCTGTTCACGCTGGCCAGGCCCACCCGGCTGCTCGAC
GGGATCCCCGCGGCCCAGCGGGTCCTCGACGCCTCCTCGGAGAGCGCCGAGGCCTCGGAG
AACGCCTCGGCCCTCCGTCGCGAACTGACGGCCCTGCCCGTGCGGGAGCGGACCGGGGCA
CTTCTCGACCTGGTCCGCAAACAGGTGGCCGCCGTCCTGCGCTACGAGCCGGGCCAAGAC
GTGGCGCCCGAGAAGGCCTTCAAGGACCTGGGCTTCGACTCGCTCGTGGTCGTGGAGCTG
CGCAACCGGCTGCGCGCCGCCACCGGGCTCCGGCTGCCCGCCACCCTGGTCTACGACTAC
CCCACACCCCGCACCCTCGCCGCACACCTGCTGGACAGGGTGCTGCCCGACGGCGGCGCG
GCAGAGCTCCCCGTGGCCGCCCACCTGGACGACCTGGAGGCGGCCCTCACCGACCTGCCG
GCCGACGACCCCCGGCGCAAGGGCCTGGTCCGGCGTCTACAGACGCTGCTGTGGAAGCAG
CCCGACGCCATGGGGGCGGCGGGCCCCGCCGACGAGGAGGAGCAAGCCGCGCCCGAGGAC
CTGTCGACCGCGAGCGCCGACGACATGTTCGCCCTGATCGACCGGGAGTGGGGCACGCGG
TGA
[9] KS41..416
[9] AT582..903
[9] malonyl-CoA773..777
[9] KR1264..1433
[9] ACP1541..1611
[9] KS121..1248
[9] AT1744..2709
[9] malonyl-CoA2317..2331
[9] KR3790..4299
[9] ACP4621..4833

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [581-704]  1.69999999999998e-72 G3DSA:3.40.366.10 [772-880]  1.69999999999998e-72 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1569-1584]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1540-1614]  1.6e-22 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1533-1628]  2.60000517657733e-23 SSF47336
SSF47336   ACP_like
 [1544-1610]  8.20000000000001e-13 PF00550
PF00550   PP-binding
 [1541-1611]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1264-1433]  6.3e-24 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [41-290]  2.30000000000004e-92 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [298-416]  1e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [582-903]  1.10000000000001e-65 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [10-34]  1.8e-13 PF08990
PF08990   Docking
 [4-41]  1.29999924468179e-10 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [580-867]  2.1000026783403e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [709-772]  2.59999946718995e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [43-302]  6.10000000000004e-86 G3DSA:3.40.47.10 [303-468]  5.99999999999995e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [33-414]  3.60002015031011e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1264-1433]  5.59999999999999e-11 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [203-219]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [584-884]  9.20006495413779e-111 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1542-1614]  2.69998997787809e-36 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [43-468]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit