close all open/close all

CDS information : Monen_00220


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction76,541 / 75,051 / - [in whole cluster]
76,541 / 75,051 / - [in contig]
Locationcomplement(75051..76541) [in whole cluster]
complement(75051..76541) [in contig]
TypeCDS
Length1,491 bp (496 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productepoxidase
Product (GenBank)monensin epoxidase
GenemonCI
Gene (GenBank)monC1
EC number
Keyword
Note
Note (GenBank)
  • FAD dependent monooxygenase; MonC1
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
[16217816] Accumulation of an E,E,E-triene by the monensin-producing polyketide synthase when oxidative cyclization is blocked. (Angew Chem Int Ed Engl. , 2005)

close this sectionSequence

selected fasta
>epoxidase [monensin epoxidase]
MTTTRPAHAVVLGASMAGTLAAHVLARHVDAVTVVERDALPEEPQHRKGVPQARHAHLLW
SNGARLIEEMLPGTTDRLLAAGARRLGFPEDLVTLTGQGWQHRFPATQFALVASRPLLDL
TVRQQALGADNITVRQRTEAVELTGSGGGSGGRVTGVVVRDLDSGRQEQLEADLVIDATG
RGSRLKQWLAALGVPALEEDVVDAGVAYATRLFKAPPGATTHFPAVNIAADDRVREPGRF
GVVYPIEGGRWLATLSCTRGAQLPTHEDEFIPFAENLNHPILADLLRDAEPLTPVFGSRS
GANRRLYPERLEQWPDGLLVIGDSLTAFNPIYGHGMSSAARCATTIDREFERSVQEGTGS
ARAGTRALQKAIGAAVDDPWILAATKDIDYVNCRVSATDPRLIGVDTEQRLRFAEAITAA
SIRSPKASEIVTDVMSLNAPQAELGSNRFLMAMRADERLPELTAPPFLPEELAVVGLDAA
TISPTPTPTPTAAVRS
selected fasta
>epoxidase [monensin epoxidase]
GTGACCACCACCCGACCCGCACATGCCGTCGTCCTGGGTGCCAGCATGGCAGGCACCCTG
GCGGCCCACGTCCTGGCCCGGCACGTCGACGCCGTCACCGTCGTGGAACGTGACGCGCTG
CCCGAGGAGCCCCAGCACCGCAAGGGGGTCCCGCAGGCCCGCCACGCGCACCTCCTGTGG
TCCAACGGCGCCCGCCTCATCGAGGAGATGCTGCCCGGCACCACCGACCGCCTCCTCGCG
GCCGGCGCCCGCCGCCTCGGCTTCCCCGAGGACCTGGTGACGCTGACCGGTCAGGGGTGG
CAGCACCGCTTCCCCGCCACCCAGTTCGCGCTGGTCGCCAGCCGCCCGCTGCTGGACTTG
ACGGTACGTCAGCAGGCCTTGGGAGCCGACAACATCACCGTCCGGCAGCGCACCGAGGCC
GTCGAGCTGACGGGAAGTGGTGGTGGCAGTGGCGGCCGGGTCACCGGTGTCGTCGTCCGC
GACCTCGACAGCGGTCGGCAGGAGCAGCTGGAGGCCGACCTGGTGATCGACGCCACCGGG
CGCGGCTCCCGCCTCAAGCAGTGGCTCGCCGCCCTCGGCGTGCCGGCACTGGAGGAAGAC
GTCGTGGACGCGGGCGTCGCCTACGCCACCCGGCTCTTCAAGGCCCCGCCGGGCGCTACG
ACGCACTTCCCCGCCGTGAACATCGCCGCCGACGACCGGGTGCGCGAACCCGGCCGCTTC
GGCGTGGTCTACCCCATCGAGGGCGGCCGCTGGCTCGCGACGCTCTCCTGCACGCGGGGC
GCGCAACTGCCCACACACGAGGACGAGTTCATCCCCTTCGCCGAGAACCTGAACCACCCG
ATCCTCGCCGACCTGCTCCGGGACGCCGAACCACTCACCCCCGTCTTCGGTTCCCGCTCC
GGCGCCAACCGCCGCCTCTATCCGGAGCGCCTCGAACAGTGGCCCGACGGTCTGCTCGTC
ATCGGCGACTCGCTGACCGCTTTCAACCCGATCTACGGCCACGGCATGAGCTCGGCCGCG
CGCTGCGCCACCACGATCGACCGCGAGTTCGAGCGGAGCGTGCAGGAGGGTACGGGGTCC
GCCCGCGCCGGCACCCGCGCCCTGCAGAAGGCGATCGGCGCGGCCGTGGACGACCCGTGG
ATCCTCGCCGCGACCAAGGACATCGACTACGTCAACTGCCGTGTCTCGGCGACGGATCCG
CGGCTCATCGGTGTGGACACCGAGCAGCGTCTGCGGTTCGCCGAGGCCATCACCGCGGCG
TCGATCCGTTCCCCGAAGGCGTCCGAGATCGTCACGGACGTGATGAGCCTCAACGCGCCG
CAGGCCGAACTGGGCTCCAACCGTTTCCTGATGGCGATGCGCGCCGACGAACGCCTCCCG
GAGCTGACCGCTCCCCCGTTCCTTCCGGAGGAGCTGGCCGTGGTGGGTCTGGACGCGGCG
ACGATCTCGCCCACGCCTACACCTACACCTACGGCGGCTGTACGGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003953 FAD binding domain (Domain)
 [121-202]  3.8e-07 PF00890
PF00890   FAD_binding_2
SignalP
 [1-31]  0.904 Signal
Bacteria, Gram-positive   
 [1-22]  0.985 Signal
Bacteria, Gram-negative   
 [1-26]  0.997 Signal
Eukaryota   
TMHMM No significant hit