close all open/close all

CDS information : Monen_00230


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction76,960 / 76,538 / - [in whole cluster]
76,960 / 76,538 / - [in contig]
Locationcomplement(76538..76960) [in whole cluster]
complement(76538..76960) [in contig]
TypeCDS
Length423 bp (140 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productepoxide hydrolase/cyclase
Product (GenBank)probable monensin biosynthesis isomerase
Gene
Gene (GenBank)monBII
EC number
Keyword
Note
  • Belongs to polyether epoxide hydrolase(PEH)-A group.
Note (GenBank)
  • MonBII
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
[16632258] Evidence for the role of the monB genes in polyether ring formation during monensin biosynthesis. (Chem Biol. , 2006)
[24320215] Allosteric regulation of epoxide opening cascades by a pair of epoxide hydrolases in monensin biosynthesis. (ACS Chem Biol. , 2014)
Related Reference
ACC
B6ZK72
NITE
Lasal_00210
PmId
[18710235] Epoxide hydrolase Lsd19 for polyether formation in the biosynthesis of lasalocid A: direct experimental evidence on polyene-polyepoxide hypothesis in polyether biosynthesis. (J Am Chem Soc. , 2008)
[21375229] Enzymatic epoxide-opening cascades catalyzed by a pair of epoxide hydrolases in the ionophore polyether biosynthesis. (Org Lett. , 2011)
[22388816] Enzymatic catalysis of anti-Baldwin ring closure in polyether biosynthesis. (Nature. , 2012)

close this sectionSequence

selected fasta
>epoxide hydrolase/cyclase [probable monensin biosynthesis isomerase]
MPDEAARKQMAVDYAERINAGDIEGVLDLFTDDIVFEDPVGRPPMVGKDDLRRHLELAVS
CGTHEVPDPPMTSMDDRFVVTPTTVTVQRPRPMTFRIVGIVELDEHGLGRRVQAFWGVTD
VTMDDPAGPADTTHPEGIRA
selected fasta
>epoxide hydrolase/cyclase [probable monensin biosynthesis isomerase]
ATGCCCGACGAGGCCGCGCGCAAGCAGATGGCCGTCGACTACGCCGAGCGCATCAACGCC
GGTGACATCGAAGGCGTCCTCGACCTGTTCACGGACGACATCGTCTTCGAGGACCCCGTG
GGGCGGCCCCCGATGGTGGGCAAGGACGATCTCCGCCGCCATCTCGAACTGGCCGTCTCC
TGCGGTACGCACGAGGTGCCGGACCCGCCGATGACGTCGATGGACGACCGTTTCGTGGTG
ACGCCGACCACGGTCACCGTGCAGCGGCCGCGGCCGATGACCTTCCGCATCGTCGGCATC
GTCGAACTCGACGAGCACGGGCTCGGCCGCCGGGTCCAGGCGTTCTGGGGCGTCACGGAC
GTGACCATGGACGATCCGGCCGGGCCCGCCGACACCACCCACCCCGAAGGGATACGCGCG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [13-107]  7.09999999999999e-11 PF12680
PF12680   SnoaL_2
SignalP
 [1-20]  0.035 Signal
Bacteria, Gram-negative   
TMHMM No significant hit