close all open/close all

CDS information : Monen_00260


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction93,741 / 88,816 / - [in whole cluster]
93,741 / 88,816 / - [in contig]
Locationcomplement(88816..93741) [in whole cluster]
complement(88816..93741) [in contig]
TypeCDS
Length4,926 bp (1,641 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)monensin polyketide synthase module 10
Gene
Gene (GenBank)monAVII
EC number
Keyword
Note
Note (GenBank)
  • MonAVII
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionPKS/NRPS Module

10 methylmalonyl-CoA
KS35..411
AT568..884
KR1206..1385
ACP1486..1555

close this sectionSequence

selected fasta
>polyketide synthase [monensin polyketide synthase module 10]
MAHTEEKLLEYLKRVTADLRQTERRLQDVESAGHEPVAVIGMACRLPGGVRSPEEFWELV
STGGDAVAPLPGNRNWDLDSLYDPDPESTGTSYVREGGFVYDAGDFDPTFFGIGPTEAAA
MAPQQRLALETAWEAIERAGIDPLSLRSSDTSTFIGCDGLDYALGASEVPEGTAGYFTIG
NSGSVTSGRVAYTLGLEGPAVTVDTACSSSLVSLHLATQALRTQECSLALAGGTYVMSSP
APLIGFSELRGLAPDGRCKPFSASSDGMGMAEGTGVVLLERLSDARRKGHKVLAVIRGSA
INQDGASNGLTAPNGPAQERVIRAALANARLAPEDIDAVEAHGTGTTLGDPIEAGALISA
YGRERPEDRPLWVGAVKSNIGHTQIAAGVAGVIKMVLALRHDLLPAILHVDAPSPHVEWD
GSGLRLLTDPVKWPRGERPRRAGVSSFGFSGTNAHLILEEAPPEEEDVPGSVAEEPGGVV
PWVVSGRTPDALRAQARRLGEFAAGPADASAADVGWSLTTTRSVFEHRAVVVGRDRDALT
AGLGALAAGEASAGVVAGVAGDVGPGPVLVFPGQGSQWVGMGAQLLDESPVFAARIAECE
RALSAYVDWSLSAVLRGDGSELSRVEVVQPVLWAVMVSLAAVWADYGVTPAAVIGHSQGE
MAAACVAGALSLEDAARIVAVRSDALRRLQGHGDMASLSTGAEQAAELIGDRPGVVVAAV
NGPSSTVISGPPEHVAAVVADAEARGLRARVIDVGYASHGPQIDQLHDLLTERLADIRPA
NTDVAFYSTVTAERLTDTTALDTDYWVTNLRQPVRFADTIEALLADGYRLFIEASAHPVL
GLGMEETIEQADIPATVVPTLRRDHGDTTQLTRAAAHAFTAGAPVDWRRWFPADPTPRTV
DLPTYAFQHQHYWLERSASASGAVSGEQSAAEAQLWHAVEELDLGLLAETLGSEEGSEEA
VRALEPALPVLKGWRRRHQDQATIDSWRYRVTWKQRSDGPAPELGGDWLLFVPADKAEHP
AVRATAEALSEHGAAAVRLHPVETGRAGRQELAAVDTAGLAGIVNLLALDEEPHPEHPAV
PAGLAATTALLQALGDNGTTAPLHTVTQGAVSTGATDPLTHPLQAHVWGLGRVAALEHPR
LWAGLVDLPARIDRHTLPRLAAALLPQDDEDQTAVRPTGIHHRRLTHAVGSIQNPVHSEA
TWRPRGTTLITGGTGGIGAVLARWLARQGAPRLHLTSRRGPDAPGARELAAELDGLGTAV
TITACDVSDPRQLSGLIDDMPAEHPLTAVIHAAGMTDLTAIGDLTTARLGEVLGSKSDAA
WNLHELTRDLDLSAFVMFSSGAGVWGSGQQGAYGAANHFLDALAEHRRAQGLPATSIAWG
PWAEAGMSADPESLTYFKRFGLLPIAPDLCVKALHQAVDAGDATLTVANFDWAKFTPTFT
AQRPSPFLDDLPENQREAEQTGTAAETSAFREELAKTPASQRLGFLVQQVRTYAAATLGR
TVEDIPAAKPFQELGFDSLTAVQLRNQLNTTTGLSLPATVIFDHPTPEALATHLRGQLGD
GAEVAGEGDVLAALDKWDTAFGAAEVDEAARRRIVGRLQVLVSKWSPAQDGPEGTDSAHA
DLEAASADDIFDLISSEFGKS
selected fasta
>polyketide synthase [monensin polyketide synthase module 10]
ATGGCGCACACCGAAGAGAAACTTCTGGAATACCTCAAGCGTGTCACCGCGGACCTGCGT
CAGACGGAACGCCGGCTGCAGGACGTCGAGTCGGCGGGCCACGAACCGGTCGCGGTCATC
GGCATGGCCTGCCGGCTGCCCGGCGGAGTCCGGTCTCCCGAAGAGTTCTGGGAGCTGGTC
TCCACCGGCGGCGACGCCGTCGCGCCCCTGCCCGGCAACCGCAACTGGGACCTCGATTCC
CTCTACGACCCGGACCCCGAGAGCACCGGCACCAGTTACGTCCGGGAAGGCGGCTTCGTC
TACGACGCCGGTGACTTCGACCCCACCTTCTTCGGCATCGGACCCACCGAGGCCGCGGCC
ATGGCGCCGCAGCAGCGGCTCGCCCTGGAGACGGCGTGGGAGGCGATCGAACGGGCCGGC
ATCGACCCCCTCAGCCTCCGCTCCAGCGACACCAGCACCTTCATCGGCTGTGACGGACTC
GACTACGCCCTCGGCGCGTCCGAGGTCCCCGAGGGCACCGCCGGATACTTCACCATCGGC
AACTCCGGCAGCGTCACCTCCGGCCGCGTCGCCTACACCCTGGGCCTCGAAGGCCCCGCG
GTGACGGTCGACACGGCGTGCTCCTCGTCGCTGGTCTCCCTTCACCTCGCCACCCAGGCC
CTGCGCACACAGGAGTGCTCGCTGGCGCTGGCGGGCGGCACGTACGTGATGTCGTCGCCC
GCCCCGCTGATCGGCTTCAGCGAACTGCGCGGCCTGGCCCCCGACGGACGGTGCAAGCCG
TTCTCGGCGAGCAGCGACGGCATGGGCATGGCGGAGGGTACGGGGGTGGTTCTCCTTGAG
CGTCTCTCCGACGCCCGCAGGAAGGGCCACAAGGTCCTCGCGGTGATCCGGGGTTCGGCG
ATCAACCAGGACGGCGCGAGCAATGGCCTGACCGCCCCCAACGGCCCCGCCCAGGAACGC
GTCATCCGCGCCGCCCTCGCCAACGCCCGCCTCGCCCCCGAGGACATCGACGCCGTGGAG
GCGCACGGCACCGGCACCACGCTCGGCGACCCCATCGAGGCCGGGGCTCTCATCTCCGCC
TACGGCCGGGAACGGCCGGAGGACCGGCCGCTGTGGGTGGGAGCGGTGAAGTCCAACATC
GGCCACACGCAGATCGCCGCCGGTGTGGCCGGTGTCATCAAGATGGTCCTGGCCCTGCGG
CACGACCTGCTGCCCGCCATCCTGCACGTCGACGCCCCCTCGCCCCACGTGGAGTGGGAC
GGCAGCGGGCTGCGCCTGCTCACCGACCCGGTGAAGTGGCCCCGGGGCGAGCGCCCGCGC
CGGGCGGGGGTGTCCTCGTTCGGCTTCTCGGGGACGAACGCGCATCTGATCCTGGAGGAG
GCACCACCGGAGGAGGAGGACGTGCCGGGCTCCGTGGCCGAGGAGCCGGGTGGGGTCGTT
CCGTGGGTGGTGTCCGGGCGGACGCCGGACGCGCTGCGTGCACAGGCGCGGCGGCTGGGC
GAGTTCGCGGCCGGGCCGGCGGATGCGTCGGCGGCTGATGTGGGCTGGTCGTTGACCACG
ACCCGGTCGGTGTTCGAGCACCGGGCTGTGGTGGTGGGGCGTGACCGCGATGCGTTGACG
GCTGGCCTGGGGGCGTTGGCTGCGGGTGAGGCTTCGGCGGGTGTGGTGGCCGGGGTTGCT
GGTGATGTGGGTCCTGGGCCGGTGTTGGTGTTTCCGGGGCAGGGGTCGCAGTGGGTGGGC
ATGGGTGCCCAGCTGCTGGACGAGTCCCCCGTCTTCGCGGCGCGGATTGCGGAGTGTGAG
CGGGCGCTGTCGGCGTATGTGGACTGGTCGCTGAGTGCGGTGTTGCGCGGGGATGGGAGT
GAGCTGTCCCGGGTCGAGGTCGTGCAGCCGGTGTTGTGGGCGGTGATGGTCTCGCTGGCT
GCGGTGTGGGCTGATTACGGGGTCACTCCGGCTGCTGTGATCGGGCACTCGCAGGGTGAG
ATGGCTGCCGCGTGCGTCGCGGGGGCGCTGTCGCTGGAGGATGCGGCGCGCATCGTAGCC
GTACGCAGTGACGCGCTTCGTCGGCTGCAAGGGCACGGTGACATGGCCTCGCTGAGCACC
GGTGCCGAGCAGGCCGCTGAGCTGATCGGTGACCGGCCGGGCGTGGTCGTCGCGGCGGTC
AATGGGCCGTCGTCTACGGTGATTTCAGGGCCGCCGGAGCATGTGGCTGCCGTGGTCGCC
GATGCGGAGGCACGTGGTCTGCGCGCCCGTGTCATCGACGTCGGGTACGCCTCGCATGGC
CCCCAGATCGACCAGCTCCACGATCTGCTGACCGAACGCCTGGCTGACATCCGGCCCGCG
AACACGGACGTGGCCTTCTATTCGACGGTCACCGCCGAGCGTCTGACGGACACCACAGCC
CTGGATACGGATTACTGGGTGACCAACCTCCGCCAGCCGGTCCGGTTCGCCGACACCATC
GAAGCCCTTCTCGCGGACGGCTACCGCCTGTTCATCGAGGCCAGCGCCCACCCCGTGCTG
GGCCTGGGCATGGAGGAGACCATCGAGCAGGCGGACATCCCCGCCACCGTCGTCCCCACC
CTCCGCCGCGACCACGGCGACACCACCCAGCTCACCCGTGCCGCCGCCCACGCCTTCACC
GCCGGCGCCCCCGTCGACTGGCGGCGCTGGTTCCCGGCCGACCCCACCCCCCGCACCGTC
GACCTCCCCACCTACGCCTTCCAACACCAGCACTACTGGCTCGAACGTTCCGCGTCCGCC
TCGGGCGCCGTCAGCGGTGAGCAGAGTGCGGCCGAGGCCCAGCTGTGGCACGCCGTCGAG
GAGCTCGATCTCGGTCTGCTGGCCGAGACGCTGGGGTCGGAGGAGGGCAGCGAGGAGGCG
GTCCGGGCGCTGGAGCCCGCGTTGCCGGTGCTCAAGGGCTGGCGGCGTCGGCACCAGGAC
CAGGCGACCATCGACTCCTGGCGGTACCGCGTCACGTGGAAACAGCGGTCCGACGGGCCC
GCACCGGAACTCGGCGGCGACTGGCTGCTGTTCGTCCCTGCCGACAAGGCGGAGCACCCC
GCCGTACGAGCCACCGCCGAGGCGTTGAGCGAGCACGGGGCGGCCGCCGTCCGGCTGCAT
CCGGTCGAGACCGGCCGGGCGGGACGTCAGGAGCTGGCCGCGGTGGACACGGCCGGTCTT
GCCGGAATCGTCAATCTGCTGGCGCTGGACGAGGAGCCGCACCCCGAGCACCCCGCCGTG
CCCGCGGGGCTCGCCGCGACGACCGCTCTCCTCCAGGCCCTCGGCGACAACGGCACGACC
GCACCCCTGCACACCGTCACGCAGGGTGCCGTGTCCACGGGCGCCACCGACCCACTCACC
CACCCCCTCCAGGCTCACGTCTGGGGGCTCGGCCGCGTCGCAGCCCTCGAACACCCGCGC
CTCTGGGCCGGACTCGTCGACCTCCCCGCTCGTATCGACCGCCACACCCTCCCCCGCCTC
GCCGCCGCTCTCCTCCCCCAGGACGACGAGGACCAGACCGCCGTCCGCCCCACCGGAATC
CACCACCGGCGCCTCACGCACGCCGTCGGAAGCATTCAGAATCCCGTGCACAGCGAGGCC
ACCTGGCGGCCTCGGGGCACCACCCTGATCACCGGCGGGACCGGCGGCATCGGTGCCGTC
CTCGCCCGTTGGCTGGCCCGGCAGGGCGCCCCCCGTCTTCACCTCACCAGCCGTCGCGGG
CCCGACGCGCCCGGCGCCCGGGAACTCGCCGCCGAGCTCGACGGGCTCGGCACCGCCGTC
ACCATCACCGCCTGCGACGTCAGCGATCCCCGCCAACTGAGCGGCCTCATCGACGACATG
CCGGCCGAGCATCCCCTCACAGCCGTCATCCACGCGGCGGGCATGACCGATCTGACCGCG
ATCGGTGATCTGACGACCGCGCGCCTCGGCGAGGTGCTGGGGTCGAAGTCCGACGCGGCC
TGGAACCTGCACGAGTTGACGCGCGACCTGGACCTCTCGGCGTTCGTGATGTTCTCGTCG
GGCGCCGGCGTGTGGGGCAGTGGCCAGCAGGGCGCCTATGGTGCGGCCAACCACTTCCTC
GACGCCCTCGCCGAGCACCGCCGCGCCCAGGGCCTGCCCGCCACCTCCATCGCCTGGGGG
CCCTGGGCCGAGGCGGGCATGTCCGCCGACCCGGAGTCACTGACGTACTTCAAGCGCTTC
GGTCTGCTCCCGATCGCTCCGGATCTGTGCGTCAAGGCGCTGCACCAGGCGGTCGACGCG
GGCGACGCCACGCTGACCGTGGCGAACTTCGACTGGGCGAAGTTCACGCCGACGTTCACC
GCGCAGCGGCCCAGTCCGTTCCTCGACGACCTTCCGGAGAACCAGCGGGAGGCCGAGCAG
ACGGGGACCGCCGCCGAGACGAGCGCGTTCCGCGAGGAGCTGGCGAAGACGCCCGCATCA
CAGCGGCTCGGCTTCCTGGTCCAGCAGGTCCGGACATACGCGGCCGCGACGCTCGGCCGC
ACGGTGGAGGACATTCCCGCCGCGAAGCCGTTCCAGGAGCTGGGCTTCGACTCGCTCACC
GCGGTCCAGCTGCGCAACCAGCTCAACACCACGACCGGACTCTCGCTCCCCGCCACCGTG
ATCTTCGACCATCCCACGCCCGAGGCCCTCGCCACGCACTTGCGCGGACAGCTCGGCGAC
GGCGCCGAGGTCGCAGGTGAGGGCGACGTGCTCGCGGCGCTCGACAAGTGGGACACGGCG
TTCGGAGCGGCCGAGGTGGACGAGGCGGCCCGGCGCCGCATCGTGGGCCGGCTGCAGGTC
CTTGTGTCGAAGTGGAGTCCGGCGCAGGACGGGCCGGAAGGCACTGATTCGGCCCATGCC
GATCTGGAGGCGGCGAGCGCGGACGACATCTTCGACCTCATCTCCAGTGAGTTCGGGAAG
TCCTGA
[10] KS35..411
[10] AT568..884
[10] methylmalonyl-CoA756..760
[10] KR1206..1385
[10] ACP1486..1555
[10] KS103..1233
[10] AT1702..2652
[10] methylmalonyl-CoA2266..2280
[10] KR3616..4155
[10] ACP4456..4665

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [565-689]  3.79999999999991e-71 G3DSA:3.40.366.10 [756-874]  3.79999999999991e-71 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1206-1372]  4.80000000000003e-60 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1513-1528]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1486-1555]  PS50075
PS50075   ACP_DOMAIN
 [1477-1562]  2.39999798157265e-21 SSF47336
SSF47336   ACP_like
 [1488-1554]  4.6e-14 PF00550
PF00550   PP-binding
 [1486-1560]  1.9e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  1.79999999999997e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  1.99999999999999e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [568-884]  7.30000000000007e-104 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-35]  1.19999985703101e-06 SSF101173
SSF101173   Polyketide_synth_docking
 [4-28]  1.8e-10 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [566-868]  2.60000517657733e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [691-755]  1.20000117458134e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-297]  1e-84 G3DSA:3.40.47.10 [298-465]  1.9e-66 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-400]  2.2999842048857e-98 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1200-1397]  8.60000000000005e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [570-865]  1.59998835313644e-112 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1487-1558]  6.90001478563507e-32 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1206-1385]  2.80000504261099e-55 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit