close all open/close all

CDS information : Monen_00270


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction93,981 / 95,273 / + [in whole cluster]
93,981 / 95,273 / + [in contig]
Location93981..95273 [in whole cluster]
93981..95273 [in contig]
TypeCDS
Length1,293 bp (430 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)monensin hydroxylase
Gene
Gene (GenBank)monD
EC number
Keyword
  • C-26 hydroxylate
Note
Note (GenBank)
  • cytochrome P450; MonD
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
[8017935] Production of 26-deoxymonensins A and B by Streptomyces cinnamonensis in the presence of Metyrapone. (Appl Environ Microbiol. , 1994)

close this sectionSequence

selected fasta
>cytochrome P450 [monensin hydroxylase]
MGLTVGPDNAKRGIVPITDSKPAATFPDLVDPSFWARPHAERVALFEEMRGLPRPAFIRQ
NMPGVPWTFGYHALVKYADIVEVSRRPQDFSSNGATTIIGLPPELDEYYGSMINMDNPEH
SRLRRIVSRSFGRNMIPEFEAVATRTARRIIDELIARGPGDFIRPVAAEMPIAVLSDMMG
IPAEDHDFLFDRSNTIVGPLDPDYVPDRADSERAVIEASRELGDYIAGLRAERLAAPGND
LITKLVQVQADGEQLTRQELVSFFILLVIAGMETTRNAISHALVLLTEHPEQKQLLLSDF
DTHAPNAVEEILRVSTPINWMRRVATRDCDMNGHRFRRGDRIFLFYWSGNRDESVFPDPY
RFDITRGTNAHVTFGAVGPHVCLGAHLARMEITVLYRELLAALPQIHAVGQPRRLDSSFI
EGIKHLHCAF
selected fasta
>cytochrome P450 [monensin hydroxylase]
GTGGGCCTGACCGTCGGTCCGGACAACGCGAAGCGAGGCATCGTGCCCATCACGGATAGC
AAGCCGGCCGCCACATTCCCCGACCTGGTCGACCCGTCGTTCTGGGCGCGGCCGCACGCG
GAACGCGTGGCGCTGTTCGAGGAGATGCGCGGGCTGCCGCGGCCGGCGTTCATCCGGCAG
AACATGCCCGGCGTGCCCTGGACGTTCGGCTACCACGCGCTGGTCAAGTACGCGGACATC
GTGGAGGTGAGCCGCCGCCCGCAGGACTTCTCCTCGAACGGCGCGACCACCATCATCGGT
CTGCCGCCCGAGCTGGACGAGTACTACGGCTCGATGATCAACATGGACAACCCGGAACAC
TCGCGGCTGCGGCGCATCGTCTCGCGTTCCTTCGGCCGCAACATGATCCCCGAGTTCGAG
GCCGTGGCGACCCGCACCGCCCGCCGCATCATCGACGAGCTCATCGCGCGGGGACCCGGC
GACTTCATCAGGCCCGTCGCCGCGGAGATGCCCATCGCCGTGCTCAGCGACATGATGGGC
ATCCCGGCGGAGGACCACGACTTCCTCTTCGACCGGTCCAACACGATCGTCGGCCCCCTC
GACCCGGACTACGTGCCGGACCGGGCGGACTCCGAACGCGCGGTGATCGAGGCGTCACGC
GAACTCGGCGACTACATCGCTGGCCTTCGTGCGGAACGGCTCGCCGCCCCCGGCAACGAC
CTCATCACCAAGCTCGTGCAAGTCCAGGCGGACGGCGAGCAGTTGACGCGGCAGGAACTC
GTCTCCTTCTTCATCCTGCTCGTCATCGCCGGGATGGAGACCACCCGCAACGCCATCTCG
CACGCGCTGGTACTGCTGACCGAGCATCCCGAGCAGAAGCAGCTGCTGCTCTCGGACTTC
GACACGCACGCGCCGAACGCGGTCGAGGAGATCCTCAGGGTCTCCACGCCCATCAACTGG
ATGCGGCGCGTCGCCACCCGCGACTGCGACATGAACGGCCACAGGTTCCGCAGGGGCGAC
CGGATCTTCCTGTTCTACTGGTCGGGCAACCGGGACGAATCCGTCTTCCCTGACCCGTAC
CGGTTCGACATCACGCGCGGGACGAACGCGCACGTCACGTTCGGCGCGGTGGGCCCGCAC
GTCTGCCTCGGGGCCCACCTCGCCCGTATGGAGATCACCGTCCTGTACCGGGAGCTGCTC
GCGGCGCTGCCCCAGATCCATGCCGTGGGGCAGCCCCGCAGGCTGGACTCCAGCTTCATC
GAAGGGATCAAGCACCTGCACTGCGCCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [270-287]  3.39999972437717e-05 PR00385 [306-317]  3.39999972437717e-05 PR00385 [382-393]  3.39999972437717e-05 PR00385
PR00385   P450
 [11-430]  4.99996518094122e-84 SSF48264
SSF48264   Cytochrome_P450
 [44-430]  1.79999999999997e-97 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [236-400]  3.8e-24 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [115-126]  5.8999880940569e-42 PR00359 [161-177]  5.8999880940569e-42 PR00359 [178-193]  5.8999880940569e-42 PR00359 [224-246]  5.8999880940569e-42 PR00359 [306-317]  5.8999880940569e-42 PR00359 [323-350]  5.8999880940569e-42 PR00359 [351-366]  5.8999880940569e-42 PR00359 [382-393]  5.8999880940569e-42 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit