close all open/close all

CDS information : Monen_00280


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction96,141 / 95,338 / - [in whole cluster]
96,141 / 95,338 / - [in contig]
Locationcomplement(95338..96141) [in whole cluster]
complement(95338..96141) [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)activator protein
Gene
Gene (GenBank)monRI
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • afsR family regulator protein; pathway-specific; MonRI
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>transcriptional activator [activator protein]
MRYEMLGPLRIKDGNDYATINAQKVEIVLTVLLIRADRVVSLEQLMREIWGEDLPRRATA
GLHVYISQLRKFLKVPGSAGNPVETRAPGYVLHKRDDDQIDAQIFPELVDVGRSLLREKR
FDEAASCFGQALALWRGPILGQGGNGPGTNGPIIDGFSTWLTEIRLECQEMLVECQLQLG
RHREAVGMLYALTAENPMCEAFYRQLMLALYRSERQADALKVYQSVRKTLNDELGLEPGR
PLQELQRAILAGDMHLMSPPPLALSGR
selected fasta
>transcriptional activator [activator protein]
GTGAGATACGAAATGCTGGGCCCGCTCCGCATCAAGGACGGAAACGACTACGCCACCATC
AACGCCCAGAAGGTGGAGATCGTCCTCACCGTGCTCCTCATCCGCGCCGACCGGGTGGTC
TCCCTGGAGCAGCTGATGCGGGAGATCTGGGGCGAGGACCTGCCGCGGCGCGCCACGGCG
GGACTGCATGTGTACATCTCCCAGCTCCGCAAGTTCCTCAAGGTGCCCGGTTCGGCGGGC
AACCCCGTCGAGACCCGTGCGCCGGGGTACGTCCTGCACAAGCGGGACGACGACCAGATC
GATGCCCAGATCTTCCCCGAACTGGTGGACGTGGGGCGGTCGTTGCTCAGGGAGAAGCGG
TTCGACGAGGCGGCCTCCTGTTTCGGGCAGGCGCTCGCGCTGTGGCGCGGCCCGATCCTC
GGGCAGGGCGGGAACGGTCCCGGCACCAACGGCCCGATCATCGACGGCTTCTCGACCTGG
CTGACCGAGATCCGCCTGGAGTGTCAGGAGATGCTCGTCGAGTGCCAGCTCCAGCTCGGC
CGGCACCGCGAGGCCGTGGGCATGCTGTACGCCCTCACCGCGGAGAACCCGATGTGCGAG
GCGTTCTACCGCCAGCTGATGCTGGCGCTCTACCGCTCCGAGCGGCAGGCGGACGCGCTG
AAGGTGTACCAGTCGGTGCGCAAGACGCTCAACGACGAGCTGGGGCTCGAACCCGGGCGC
CCGCTCCAGGAGCTGCAGCGGGCCATACTCGCGGGTGACATGCACCTGATGTCCCCACCG
CCCTTGGCCCTGTCCGGTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [14-92]  6.899999633797e-11 SM00862
SM00862   Trans_reg_C
 [28-92]  1.8e-12 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [100-250]  1.10000150671643e-47 SM01043
SM01043   BTAD
 [100-250]  3.99999999999998e-50 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [108-226]  3.7e-09 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [28-93]  7.90000000000001e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-93]  3.0999994589937e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit