close all open/close all

CDS information : Monen_00290


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction96,941 / 96,138 / - [in whole cluster]
96,941 / 96,138 / - [in contig]
Locationcomplement(96138..96941) [in whole cluster]
complement(96138..96941) [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Producttype II thioesterase
Product (GenBank)thioesterase
Gene
Gene (GenBank)monAX
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • MonAX
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>type II thioesterase [thioesterase]
MSAFPPPDMSDPWIRRFRPRPEAVVRLVCFPHAGGSASYYHPLAQSPTLPTDSEVLAVQY
PGRQDRRRERLLDDIGELADLITDALGPFDDRPLAFFGHSMGAVLAYEVAQRLRERTGKQ
PCRLFVSGRRAPSRFRRGTVHLLDDTELAAELRRAGGTDPRFLDDEELLAEIIPVVRNDY
RAVELYRWNPSPPLSCPITALVGDRDPQAPLDEVEAWQQHTEGPFDLKVFAGGHFYLNTH
QQGVTEVISKALADSAQQRATARGNAR
selected fasta
>type II thioesterase [thioesterase]
TTGTCTGCCTTCCCCCCACCCGATATGTCGGACCCTTGGATACGTCGCTTCCGGCCCCGA
CCGGAAGCCGTCGTTCGCCTGGTCTGCTTCCCCCACGCGGGCGGCTCGGCCTCCTACTAC
CACCCCCTTGCGCAATCCCCCACTCTCCCGACCGACAGCGAGGTCCTCGCGGTGCAGTAC
CCCGGGCGACAGGACCGCCGCAGAGAGCGGCTCCTGGACGACATCGGGGAACTCGCCGAC
CTCATCACCGATGCGCTCGGCCCGTTCGACGACCGCCCGTTGGCGTTCTTCGGCCACAGC
ATGGGCGCCGTCCTCGCCTACGAAGTCGCCCAGCGGCTCCGCGAGCGCACGGGGAAGCAG
CCCTGCCGGCTGTTCGTCTCGGGACGCCGCGCGCCGTCCCGCTTCCGGCGCGGCACCGTA
CACCTCCTCGACGACACCGAGTTGGCCGCCGAGCTGCGCCGGGCCGGTGGCACTGACCCG
CGGTTCCTGGACGACGAGGAACTGCTCGCGGAGATCATCCCGGTCGTCCGCAACGACTAC
CGGGCGGTCGAGCTGTACCGGTGGAACCCGTCGCCGCCGCTGTCCTGCCCCATCACCGCC
CTGGTGGGCGACCGGGACCCGCAGGCGCCGCTGGACGAGGTCGAGGCCTGGCAGCAGCAC
ACGGAAGGCCCCTTCGACCTCAAGGTCTTCGCCGGGGGCCACTTCTATCTGAACACGCAC
CAGCAGGGCGTCACGGAAGTCATCTCCAAGGCCCTGGCCGACAGTGCGCAGCAGCGTGCG
ACAGCAAGGGGGAACGCTCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [26-250]  1.2e-59 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit