close all open/close all

CDS information : Monen_00300


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction97,580 / 98,953 / + [in whole cluster]
97,580 / 98,953 / + [in contig]
Location97580..98953 [in whole cluster]
97580..98953 [in contig]
TypeCDS
Length1,374 bp (457 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • conserved hypothetical protein; SCN_30
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MSESMAWLTRDVRKARKEGSAGTARRRADRLADLVAHARSASPYYRELYHGLPERIEDPT
LLPVTDKKQLMDHFDDWPTDRDITFEKVRAFTDDPELIGRRFLGRYLVATTSGTSGRRGL
FVLDDRYMNVSSAVSSRVLASWLGPLGIARAVVHGGRFAQLVATEGHYVGFAGYSRLRQD
GGARSKLVRAFSVHEPMSRLVAELNEYRPAFVIGYASTIMLLTAEQEAGRLHIDPVLVEP
AGETMTESDTDRIAAAFGAKVRTMYSATECTYLSHGCAEGWYHVNDDWAVLEPVDADHRP
TPPGEFSHTTLISNLANRVQPFLRYDLGDSVMLRPDPCPCGTPSPAIRVQGRSGDILTFP
SGRGDDVSLAPLAFSSLFDRMPGVELFQIEQTAPSTLRVRVVQAPGADADHVWQRAHDGL
THLLADNKLDNVTVERGEEPPRQASGGKYRTIIPLAA
selected fasta
>hypothetical protein [unknown]
ATGAGCGAGAGCATGGCGTGGCTGACGCGGGACGTCCGCAAGGCCCGCAAGGAGGGCAGT
GCGGGGACCGCGCGGCGCCGAGCCGACCGGCTGGCGGACCTGGTCGCCCACGCCCGCTCG
GCGTCGCCGTACTACCGGGAGCTCTACCACGGCCTGCCCGAGCGGATCGAGGACCCGACG
CTGCTGCCGGTGACGGACAAGAAGCAGCTGATGGACCACTTCGACGACTGGCCGACGGAC
CGCGACATCACCTTCGAGAAGGTCCGCGCGTTCACCGACGACCCCGAGCTGATCGGGCGG
CGCTTCCTCGGCCGCTATCTGGTGGCCACCACGTCGGGCACCAGCGGCAGGCGCGGCCTG
TTCGTGCTCGACGACCGGTACATGAACGTGTCCTCCGCCGTCTCCTCCCGGGTGCTCGCC
TCCTGGCTCGGCCCCCTCGGCATCGCCCGGGCCGTCGTCCACGGCGGCCGCTTCGCCCAA
CTCGTCGCCACCGAGGGACATTACGTCGGCTTCGCCGGATACTCCCGCCTGCGCCAGGAC
GGCGGAGCGCGCAGCAAGCTCGTCCGCGCCTTCTCTGTGCACGAGCCGATGTCACGTCTG
GTCGCCGAACTCAACGAGTACCGGCCCGCGTTCGTCATCGGCTACGCCAGTACGATCATG
CTGCTCACCGCCGAACAGGAAGCGGGCCGGCTGCACATCGACCCGGTGCTGGTCGAGCCC
GCGGGCGAGACGATGACCGAGAGCGACACCGACCGCATCGCTGCGGCGTTCGGCGCCAAG
GTGCGCACGATGTACAGCGCGACCGAGTGCACCTACCTCAGCCACGGCTGCGCCGAGGGC
TGGTACCACGTCAACGACGACTGGGCCGTGCTCGAACCGGTCGACGCCGACCACCGGCCC
ACCCCGCCGGGGGAGTTCTCGCACACCACCCTGATCAGCAACCTCGCCAACCGCGTCCAG
CCGTTCCTCCGCTACGACCTGGGCGACAGCGTCATGCTCCGCCCCGACCCCTGCCCCTGC
GGCACCCCCTCGCCCGCGATCCGGGTCCAGGGCAGGTCGGGCGACATCCTCACCTTCCCC
TCGGGCCGGGGCGACGACGTCAGCCTCGCCCCGCTCGCCTTCAGCAGCCTCTTCGACCGC
ATGCCCGGAGTCGAGCTCTTCCAGATCGAGCAGACCGCGCCGTCGACCCTGCGCGTCCGC
GTGGTCCAGGCGCCCGGCGCCGACGCGGACCACGTGTGGCAGCGGGCCCACGACGGGCTG
ACCCACCTCCTCGCCGACAACAAGCTCGACAACGTAACCGTCGAACGGGGCGAGGAGCCG
CCGCGGCAGGCATCCGGCGGCAAGTACCGGACGATCATCCCGCTCGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit