close all open/close all

CDS information : Monen_00310


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction99,983 / 98,991 / - [in whole cluster]
99,983 / 98,991 / - [in contig]
Locationcomplement(98991..99983) [in whole cluster]
complement(98991..99983) [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative lipase
Product (GenBank)putative lipase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • SCN_31
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
P41365
PmId
[8527460] Crystallographic and molecular-modeling studies of lipase B from Candida antarctica reveal a stereospecificity pocket for secondary alcohols. (Biochemistry. , 1995)
ACC
O33969
PmId
[9293006] Genetic and biochemical characterization of a new extracellular lipase from Streptomyces cinnamomeus. (Appl Environ Microbiol. , 1997)

close this sectionSequence

selected fasta
>putative lipase [putative lipase]
MRLSSWLGGLVAAVLAATVLPASAASAADVSSPPLEIPAAELAKALHCGTELGDLRDAGD
KPTVLFVPGTGLKGEENYAWNYMAELKKKGYQSCWVDSPGRGLRDMQESVEYVVYATRAI
QEATGRKVDLVGHSQGGLLTAWALRFWPDLPGKVDDMVTLGSPFQGTRLASPCRPIAEVA
GCPASVLQFARDSNWSKALGADGTPMPAGPSYTTIYSYADESVVADGEAPSLPGAHRIGV
QDICPGRPWPTHIAMVVDQVSYDLVADAIEHPGPADTSRIDRAHCAKPVMPLNSQEAVDA
LPGLLNFPIELLIHSQPWVDEEPPLRPYAR
selected fasta
>putative lipase [putative lipase]
GTGCGCTTGTCCTCATGGCTCGGCGGACTCGTGGCGGCCGTGCTGGCCGCCACCGTGCTT
CCGGCCTCCGCCGCTTCGGCGGCGGATGTTTCCTCTCCCCCGTTGGAGATACCGGCGGCC
GAGCTCGCCAAGGCGCTGCACTGCGGGACGGAGCTGGGGGACCTGCGTGACGCCGGTGAC
AAGCCGACCGTCCTCTTCGTGCCCGGGACCGGCCTCAAGGGCGAGGAGAACTACGCCTGG
AACTACATGGCCGAGTTGAAGAAGAAGGGCTACCAGTCCTGTTGGGTGGATTCTCCCGGT
CGCGGGCTCCGTGACATGCAGGAGTCCGTCGAGTACGTGGTGTACGCGACCCGCGCGATC
CAGGAGGCCACCGGCCGGAAGGTCGATCTCGTCGGGCACAGCCAGGGCGGCCTCCTCACG
GCGTGGGCCCTGCGCTTCTGGCCGGACCTGCCGGGGAAGGTCGACGACATGGTGACCCTG
GGCTCCCCGTTCCAGGGGACCCGGCTGGCCTCGCCCTGCCGCCCGATCGCCGAGGTGGCG
GGCTGCCCGGCGTCGGTCCTGCAGTTCGCCCGCGACTCGAACTGGTCGAAGGCTCTGGGC
GCCGACGGCACGCCCATGCCCGCAGGACCGTCGTACACCACGATCTATTCATACGCCGAC
GAGTCCGTGGTGGCCGACGGGGAGGCGCCGTCGCTGCCGGGCGCCCACCGCATCGGCGTC
CAGGACATCTGTCCGGGTCGGCCGTGGCCGACCCACATCGCCATGGTCGTCGACCAGGTC
AGCTACGACCTGGTCGCCGATGCGATCGAGCACCCCGGTCCCGCCGACACGAGCCGCATC
GACCGCGCGCACTGCGCCAAGCCGGTCATGCCGCTCAACAGCCAGGAGGCCGTCGACGCC
CTGCCCGGCCTGCTGAACTTCCCGATCGAGCTGCTGATCCACAGCCAGCCGTGGGTCGAC
GAGGAGCCTCCGCTGCGCCCGTACGCGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-27]  1 Signal
Bacteria, Gram-positive   
 [1-27]  1 Signal
Eukaryota   
 [1-27]  1 Signal
Bacteria, Gram-negative   
TMHMM No significant hit