close all open/close all

CDS information : Monen_00320


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction101,433 / 100,507 / - [in whole cluster]
101,433 / 100,507 / - [in contig]
Locationcomplement(100507..101433) [in whole cluster]
complement(100507..101433) [in contig]
TypeCDS
Length927 bp (308 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative cation efflux protein
Product (GenBank)hypothetical transport protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • SCN_32
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
O07084
PmId
[9099864] A Bacillus subtilis locus encoding several gene products affecting transport of cations. (Gene. , 1997)
[12100555] An antiport mechanism for a member of the cation diffusion facilitator family: divalent cations efflux in exchange for K+ and H+. (Mol Microbiol. , 2002)
ACC
P13512
PmId
[2678100] Expression and nucleotide sequence of a plasmid-determined divalent cation efflux system from Alcaligenes eutrophus. (Proc Natl Acad Sci U S A. , 1989)
[9044283] Two-component regulatory system involved in transcriptional control of heavy-metal homoeostasis in Alcaligenes eutrophus. (Mol Microbiol. , 1997)
ACC
P75757
PmId
[11443104] ZitB (YbgR), a member of the cation diffusion facilitator family, is an additional zinc transporter in Escherichia coli. (J Bacteriol. , 2001)

close this sectionSequence

selected fasta
>putative cation efflux protein [hypothetical transport protein]
MGHDHGPSAGAAGGTLSGTYRKRLLWTIGISGSITVIQVVGALLSGSLALLADAAHSLTD
AVGVSLALGAITLAQRAPTPRRTFGFYRVEIFSAVLNALLLVVIFAWVLWSAIGRFSEPV
EVKGGLMFVVALGGLAANLVGLWLLRDAKEKSLNLRGAYLEVLGDALGSVAVIVGGLVIL
LTGWQAADPIASIVIGLLIVPRAYGLLRDSLHVLLEATPQDVDLGEVRRHLLEERGVVAV
HDLHGWTVTSGMPVLTAHVVVTEEALASGYGELLGRLQRCVGGHFDVAHSTIQLEPEGHV
EEDGALHT
selected fasta
>putative cation efflux protein [hypothetical transport protein]
ATGGGGCACGACCACGGTCCGTCCGCCGGGGCGGCGGGCGGCACTCTCAGCGGCACGTAC
CGCAAGCGCCTGCTGTGGACCATCGGCATCAGCGGCTCGATCACCGTCATCCAGGTGGTC
GGCGCGCTCCTGTCCGGCAGCCTCGCGCTGCTCGCCGACGCCGCGCACAGCCTGACCGAC
GCGGTCGGCGTCTCGCTGGCCCTCGGTGCCATCACCCTCGCCCAGCGGGCGCCGACGCCG
CGGCGCACCTTTGGGTTCTACCGCGTGGAGATCTTCTCCGCGGTCCTGAACGCGCTGCTC
CTGGTCGTCATCTTCGCCTGGGTCCTGTGGTCGGCGATCGGCCGGTTCAGCGAGCCGGTG
GAGGTGAAGGGCGGCCTGATGTTCGTGGTCGCGCTGGGCGGGCTCGCCGCCAACCTGGTG
GGCCTGTGGCTGCTGCGGGACGCCAAGGAGAAGAGCCTCAATCTGCGGGGCGCGTACCTG
GAGGTGCTGGGCGACGCGCTCGGCTCGGTCGCGGTGATCGTGGGCGGCCTGGTCATCCTG
CTCACGGGGTGGCAGGCCGCCGACCCGATCGCGTCGATCGTCATCGGCCTGCTGATCGTG
CCGCGCGCGTACGGCCTGCTGCGGGACTCCTTGCACGTCCTGCTGGAGGCGACCCCGCAG
GACGTCGACCTCGGCGAGGTGCGCCGGCACCTGCTGGAGGAGCGGGGCGTGGTCGCCGTG
CACGATCTGCACGGCTGGACGGTCACCTCGGGGATGCCGGTGCTCACCGCGCACGTGGTG
GTCACGGAGGAGGCTCTCGCGAGCGGGTACGGGGAGCTCCTGGGGCGCCTTCAGCGGTGT
GTCGGGGGCCACTTCGACGTGGCCCACTCGACGATCCAGCTGGAGCCGGAGGGGCATGTG
GAGGAGGACGGGGCGCTGCACACGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002524 Cation efflux protein (Family)
 [21-298]  4.49999999999996e-84 TIGR01297
TIGR01297   CDF
 [27-300]  1.69999999999998e-67 PF01545
PF01545   Cation_efflux
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [24-46]  Transmembrane (o-i) [91-113]  Transmembrane (i-o) [123-145]  Transmembrane (o-i) [158-180]  Transmembrane (i-o) [184-206]  Transmembrane (o-i)
Transmembrane 5