close all open/close all

CDS information : Monen_00330


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction102,581 / 101,490 / - [in whole cluster]
102,581 / 101,490 / - [in contig]
Locationcomplement(101490..102581) [in whole cluster]
complement(101490..102581) [in contig]
TypeCDS
Length1,092 bp (363 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative small-conductance mechanosensitive channel
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • SCN_33
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
P0C0S1
PmId
[12015316] Functional design of bacterial mechanosensitive channels. Comparisons and contrasts illuminated by random mutagenesis. (J Biol Chem. , 2002)
[10202137] Protection of Escherichia coli cells against extreme turgor by activation of MscS and MscL mechanosensitive channels: identification of genes required for MscS activity. (EMBO J. , 1999)
[12446901] Crystal structure of Escherichia coli MscS, a voltage-modulated and mechanosensitive channel. (Science. , 2002)
[12080120] Purification of the small mechanosensitive channel of Escherichia coli (MscS): the subunit structure, conduction, and gating characteristics in liposomes. (Biophys J. , 2002)

close this sectionSequence

selected fasta
>putative small-conductance mechanosensitive channel [unknown]
MTRALTLHDWIVAGIAVVAGVVAGLLLRALLRWLGERASKTRWSGDDVIVDALRTLVPCA
AITAGLAAAAGALPLTPRTGRNVTMTLTALLILAATLTAARIVTGLVKAVAQSRSGVAGS
ATIFVNITRVVVLAMGFLIVLQTLGISIAPLLTALGVGGLAVALALQDTLANLFAGVHIL
AAKTVQPGDYIQLSSGEEGYVVDINWRNTTVRQLSNNLVIIPNAKLAGTNMTNYSRPEQE
LSIMVQVGVSYDSDLEQVEKVTTEVVDEVMAEITGAVPDHEAAIRFHTFGDSRISFTVIL
GVGEFSDQYRIKHEFIKRLHQRYRAEGIRVPAPVRTVRVQQGELPPPLGIPHQRDTSTQA
RLH
selected fasta
>putative small-conductance mechanosensitive channel [unknown]
ATGACCCGTGCCCTCACACTGCACGACTGGATCGTGGCCGGTATCGCGGTCGTCGCCGGC
GTCGTCGCCGGGCTGCTGCTCCGCGCACTTCTGAGGTGGCTCGGCGAACGGGCGAGCAAA
ACCCGGTGGAGCGGTGACGACGTCATCGTCGACGCCCTGCGCACCCTCGTGCCCTGCGCG
GCCATCACCGCCGGGCTCGCCGCCGCGGCGGGCGCGCTGCCGCTCACGCCGCGCACCGGA
CGCAACGTCACCATGACGCTGACCGCGCTGCTCATCCTGGCCGCCACGCTCACGGCGGCC
CGGATCGTCACCGGCCTGGTGAAGGCCGTGGCACAGTCCCGCTCCGGAGTGGCCGGATCG
GCCACCATCTTCGTGAACATCACCCGCGTCGTGGTGCTCGCGATGGGCTTCCTCATCGTC
CTTCAGACCCTCGGCATCTCCATCGCACCGCTGCTCACCGCCCTCGGCGTGGGAGGTCTC
GCGGTCGCCCTCGCACTGCAGGACACGCTCGCCAATCTCTTCGCGGGCGTGCACATCCTC
GCCGCGAAGACCGTGCAGCCCGGCGACTACATCCAGCTCAGCAGCGGGGAGGAGGGCTAC
GTCGTCGACATCAACTGGCGCAACACCACGGTCCGCCAGCTCTCCAACAACCTCGTCATC
ATCCCCAACGCGAAGCTCGCCGGCACCAACATGACCAACTACAGCCGCCCCGAGCAGGAG
CTGTCGATCATGGTGCAGGTCGGGGTCAGCTACGACAGCGACCTGGAGCAGGTCGAGAAG
GTCACGACCGAGGTGGTGGACGAGGTGATGGCCGAGATCACCGGCGCGGTCCCCGACCAC
GAGGCGGCGATCCGCTTCCACACCTTCGGCGACTCGCGGATCAGCTTCACGGTGATCCTC
GGCGTCGGCGAGTTCAGCGACCAGTACCGCATCAAGCACGAGTTCATCAAGCGCCTGCAC
CAGCGTTACCGCGCCGAGGGCATCCGGGTCCCCGCCCCCGTGCGCACGGTCAGGGTGCAG
CAGGGCGAGCTGCCGCCGCCGCTCGGCATCCCGCACCAGCGCGACACCTCCACCCAGGCC
CGGCTGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006685 Mechanosensitive ion channel MscS (Family)
 [126-329]  1.2e-48 PF00924
PF00924   MS_channel
IPR010920 Like-Sm (LSM) domain (Domain)
 [168-235]  4.00000300869883e-17 SSF50182
SSF50182   Sm_like_riboprot
IPR011014 Mechanosensitive ion channel MscS, transmembrane-2 (Domain)
 [82-167]  2.70000183580794e-13 SSF82861
SSF82861   MscS_transmembr
IPR011066 Mechanosensitive ion channel MscS, C-terminal (Domain)
 [237-342]  2.30000440726534e-17 SSF82689
SSF82689   MscC_channel_C
SignalP
 [1-23]  0.534 Signal
Eukaryota   
TMHMM
 [10-32]  Transmembrane (o-i) [53-75]  Transmembrane (i-o) [85-104]  Transmembrane (o-i) [117-139]  Transmembrane (i-o) [144-166]  Transmembrane (o-i)
Transmembrane 5