close all open/close all
Monen_00330 Monen_00330   last last

CDS information : Monen_00340


close this sectionLocation

Organism
StrainATCC 15413
Entry nameMonensin
Contig
Start / Stop / Direction102,924 / 103,450 / + [in whole cluster]
102,924 / 103,450 / + [in contig]
Location102924..103450 [in whole cluster]
102924..103450 [in contig]
TypeCDS
Length527 bp (175 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative amidinotransferase(fragment)
Product (GenBank)glycine amidinotransferase
Gene
Gene (GenBank)amtA
EC number
Keyword
Note
Note (GenBank)
  • AmtA
Reference
ACC
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
Related Reference
ACC
P50441
PmId
[8313955] The amino acid sequences of human and pig L-arginine:glycine amidinotransferase. (FEBS Lett. , 1994)
ACC
P08078
PmId
[3118332] Gene cluster for streptomycin biosynthesis in Streptomyces griseus: nucleotide sequence of three genes and analysis of transcriptional activity. (Nucleic Acids Res. , 1987)
[9922132] Crystal structure of L-arginine:inosamine-phosphate amidinotransferase StrB1 from Streptomyces griseus: an enzyme involved in streptomycin biosynthesis. (Biochemistry. , 1998)

close this sectionSequence

selected fasta
>putative amidinotransferase(fragment) [glycine amidinotransferase]
MSPVNSHNEWDPLEEIIVGRLEGATIPSSHPVVACNIPTWAARLQGLAAGFEYPQRLIEP
AQQELDQFIALLQSLDVTVRRPAAVDHKHRFGTPDWQSRGFCNSCPRDSMLVVGDEIIET
PMAWPCRCFETHSYRELLKDYFRRGARWTAAPRPQLTEALYEKDFRPPEEGERCA-
selected fasta
>putative amidinotransferase(fragment) [glycine amidinotransferase]
ATGTCACCCGTCAATTCGCACAACGAGTGGGATCCGCTGGAGGAGATCATCGTCGGGCGG
CTGGAGGGCGCGACCATTCCCTCCAGCCATCCGGTCGTGGCGTGCAACATCCCGACCTGG
GCGGCACGGCTGCAGGGTCTCGCCGCCGGGTTCGAGTATCCGCAGCGGCTGATCGAGCCG
GCGCAGCAGGAGCTCGACCAGTTCATCGCTCTCCTGCAATCCCTCGACGTCACAGTGAGA
CGGCCGGCGGCCGTCGACCACAAGCACCGCTTCGGGACCCCCGACTGGCAGTCGCGCGGC
TTCTGCAATTCCTGTCCGCGGGACAGCATGCTCGTCGTCGGCGACGAGATCATCGAGACC
CCGATGGCGTGGCCGTGCCGCTGTTTCGAGACGCACTCGTACCGCGAACTCCTCAAGGAC
TACTTCCGGCGCGGCGCGCGCTGGACGGCGGCGCCGCGCCCCCAGCTCACCGAGGCCCTG
TACGAGAAGGACTTCCGCCCTCCCGAGGAGGGCGAACGATGCGCTAC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-41]  0.052 Signal
Eukaryota   
 [1-34]  0.067 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Monen_00330 Monen_00330   last last