close all open/close all
first first   Myxa_00020 Myxa_00020

CDS information : Myxa_00010


close this sectionLocation

Organism
StrainSga15
Entry nameMyxalamid
Contig
Start / Stop / Direction1,306 / 2 / - [in whole cluster]
1,306 / 2 / - [in contig]
Locationcomplement(2..1306) [in whole cluster]
complement(2..1306) [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aspartokinase
putative aspartate kinase
Product (GenBank)putative aspartokinase
Gene
Gene (GenBank)
EC number2.7.2.4
Keyword
Note
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[11182319] Novel features in a combined polyketide synthase/non-ribosomal peptide synthetase: the myxalamid biosynthetic gene cluster of the myxobacterium Stigmatella aurantiaca Sga15. (Chem Biol. , 2001)
Related Reference
ACC
Q76E53
PmId
[15277749] Characterization of the L-lysine biosynthetic pathway in the obligate methylotroph Methylophilus methylotrophus. (Biosci Biotechnol Biochem. , 2004)

close this sectionSequence

selected fasta
>putative aspartokinase [putative aspartokinase]
MRPIGSARQAGRGTSALALIVQKYGGTSVGDTERIKNVAKRCIAAQKAGHDVVVVVSAMS
GETNRLLKLVSQITERPNEREQDVVVATGEQVSIGLVALAIQTQKRKAVSFLGHQVRITT
DSTFSKARIKSIDAERIVDALKKKNIVVVAGFQGQDEHGNVTTLGRGGSDTTAVALAAAL
KADACEIYTDVDGVYTTDPNMVPAARKLERIAYEEMLELASVGAKVLQIRSVEFAMKYKV
PLWVKSSFTDDPGTLVCEEDAAMEDVLVSGIAYDKNEAKIAIRGVPDVPGVAAKIFGALD
EQSIVVDLIVQNVSKDGRTDVTFTVGKADLTKAKDVVKKIAKSVKAEGVETDDQVSKVSI
VGVGMRNHSGVAAKMFTVLAGAGVNVQMISTSEIKVSCVIHSNYTELAVRSLHTAFGLDK
PEAGAVSEVVSLKG
selected fasta
>putative aspartokinase [putative aspartokinase]
ATGCGCCCAATAGGGTCCGCGCGTCAAGCAGGAAGGGGCACAAGCGCCTTGGCACTCATC
GTCCAGAAGTATGGTGGCACCTCGGTCGGCGACACCGAGCGCATCAAGAACGTGGCGAAG
CGTTGCATCGCGGCCCAGAAGGCCGGGCATGACGTGGTGGTGGTGGTCTCCGCGATGTCC
GGAGAGACCAACCGGCTGCTTAAGCTCGTGTCCCAGATCACCGAGCGGCCCAACGAGCGC
GAGCAGGATGTGGTGGTGGCCACCGGGGAGCAGGTCTCCATCGGGCTCGTGGCCCTGGCC
ATCCAGACGCAGAAGCGCAAGGCGGTGAGCTTCCTGGGACACCAGGTCCGCATCACCACC
GACAGCACCTTCTCCAAGGCCCGTATCAAGAGCATCGACGCGGAACGCATCGTGGATGCG
CTGAAGAAGAAGAACATCGTCGTCGTGGCGGGCTTCCAGGGCCAGGACGAGCATGGCAAC
GTCACCACGTTGGGTCGCGGCGGATCGGACACCACGGCGGTGGCCCTGGCTGCCGCGCTC
AAGGCGGATGCCTGCGAGATCTACACGGATGTGGACGGTGTCTACACCACCGATCCCAAC
ATGGTCCCCGCGGCGCGCAAGCTCGAGCGCATCGCCTACGAGGAGATGTTGGAGCTGGCG
AGCGTGGGCGCCAAGGTGCTGCAGATCCGTTCGGTTGAGTTCGCGATGAAGTACAAGGTG
CCGCTCTGGGTGAAGTCCTCGTTCACGGACGATCCCGGCACGCTGGTGTGTGAGGAGGAC
GCTGCGATGGAAGACGTGCTGGTCAGTGGAATCGCCTACGACAAGAATGAGGCGAAGATC
GCCATCCGGGGCGTGCCGGACGTTCCCGGGGTGGCGGCGAAGATCTTCGGCGCGCTCGAT
GAGCAGAGCATCGTCGTGGATCTCATCGTCCAGAACGTCTCCAAGGATGGTCGCACGGAT
GTGACCTTCACCGTGGGCAAGGCGGACCTCACCAAGGCCAAGGACGTGGTGAAGAAGATC
GCCAAGTCCGTCAAGGCCGAGGGGGTAGAGACCGATGACCAGGTTTCCAAGGTGTCCATC
GTCGGCGTGGGCATGCGCAACCACTCGGGTGTGGCGGCGAAAATGTTCACGGTGCTCGCG
GGCGCGGGCGTCAACGTGCAGATGATCTCCACCTCGGAAATCAAAGTGTCCTGCGTCATC
CACTCCAACTACACGGAGCTGGCGGTCCGCTCGCTGCACACCGCGTTTGGCCTGGACAAG
CCCGAGGCGGGGGCTGTCTCCGAGGTTGTCTCCCTCAAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001048 Aspartate/glutamate/uridylate kinase (Domain)
 [19-246]  1.2e-48 PF00696
PF00696   AA_kinase
 [19-259]  1.50000965748778e-72 SSF53633
SSF53633   Aa_kinase
 [18-260]  9.3000000000001e-73 G3DSA:3.40.1160.10
G3DSA:3.40.1160.10   Aa_kinase
IPR001057 Glutamate/acetylglutamate kinase (Family)
 [49-63]  8.80000265836278e-05 PR00474 [168-195]  8.80000265836278e-05 PR00474
PR00474   GLU5KINASE
IPR001341 Aspartate kinase domain (Domain)
 [79-417]  2.39999999999997e-121 TIGR00657
TIGR00657   Asp_kinases
IPR002912 ACT domain (Domain)
 [283-340]  1.4e-10 PF01842
PF01842   ACT
IPR005260 Aspartate kinase, monofunctional class (Family)
 [6-425]  PIRSF000726
PIRSF000726   Asp_kin
 [19-417]  TIGR00656
TIGR00656   Asp_kin_monofn
IPR018042 Aspartate kinase, conserved site (Conserved_site)
 [21-29]  PS00324
PS00324   ASPARTOKINASE
SignalP No significant hit
TMHMM No significant hit
first first   Myxa_00020 Myxa_00020