close all open/close all

CDS information : Myxa_00020


close this sectionLocation

Organism
StrainSga15
Entry nameMyxalamid
Contig
Start / Stop / Direction1,363 / 2,895 / + [in whole cluster]
1,363 / 2,895 / + [in contig]
Location1363..2895 [in whole cluster]
1363..2895 [in contig]
TypeCDS
Length1,533 bp (510 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative histidine ammonia-lyase
putative histidase
Product (GenBank)putative histidine ammonium lyase
GenehutH
Gene (GenBank)
EC number4.3.1.3
Keyword
Note
Note (GenBank)
  • ORF2
Reference
ACC
PmId
[11182319] Novel features in a combined polyketide synthase/non-ribosomal peptide synthetase: the myxalamid biosynthetic gene cluster of the myxobacterium Stigmatella aurantiaca Sga15. (Chem Biol. , 2001)
Related Reference
ACC
P10944
PmId
[2454913] Cloning and nucleotide sequences of histidase and regulatory genes in the Bacillus subtilis hut operon and positive regulation of the operon. (J Bacteriol. , 1988)

close this sectionSequence

selected fasta
>putative histidine ammonia-lyase [putative histidine ammonium lyase]
MSRPRLNIDGDTLKLEEILQVARHTVTVELAPAAAARVKAARDLVDRVAAGDTPSYGINT
GFGTLAEVRIDKKDLRELQRNLILSHAAGVGSPLPLPEARVLLLLRCNVLAKGYSGIRPE
TLALALEMLNRDVVPVVPERGSVGASGDLAPLAHLALVFIGEGEAFYKGERLPAAQALER
AGLKPVVLEAKEGLALVNGTQAMCAVGTLLQLRAEMLADLADLAGAMTLEGLLGSHKPFI
PEIQDVRAHEGQKACAAHLRELLADSALVESHVNCSKVQDPYSLRCMPQVHGAAREGLSF
ARRILEVEINSATDNPLVFVETERIVSGGNFHGQPVSLALDVAAMALTQLSAISERRVEQ
LVNPALSGLPPFLAKNSGLNSGFMIAQVTSAALVAESRVLSHPASVDSIPSSAGREDHVS
MGMTAALKGRQVADFTRSCLAIELLVAAQALDYRQPTRAGKGPQAAYELIRSKIPTMEKD
RELHRDIAAVSALIDSGELLNAVRTATRGQ
selected fasta
>putative histidine ammonia-lyase [putative histidine ammonium lyase]
ATGTCCCGCCCCCGCTTGAACATTGATGGAGACACTTTGAAGCTGGAGGAAATCCTCCAG
GTGGCCCGCCACACCGTCACCGTGGAGTTGGCCCCCGCGGCCGCTGCCCGCGTGAAGGCC
GCCCGGGATCTGGTGGACCGCGTGGCCGCCGGGGACACCCCCTCCTATGGCATCAACACC
GGCTTCGGAACGCTGGCCGAGGTCCGCATCGACAAGAAGGACCTGCGCGAGTTGCAGCGC
AACCTCATCCTCTCGCACGCCGCCGGGGTAGGCTCGCCGCTTCCGCTGCCCGAGGCCCGG
GTGCTGCTCTTGCTGCGTTGCAACGTGCTGGCCAAGGGCTATTCGGGCATCCGTCCGGAG
ACGCTGGCGCTCGCGCTGGAGATGCTCAACCGCGACGTGGTGCCCGTGGTGCCCGAGCGC
GGCAGCGTGGGGGCCTCGGGGGACCTGGCACCGCTGGCGCATCTGGCGCTGGTCTTCATC
GGCGAGGGCGAGGCGTTCTACAAAGGAGAGCGGCTCCCGGCGGCCCAGGCGCTGGAGCGC
GCCGGGCTGAAGCCGGTGGTGCTGGAGGCCAAGGAGGGGCTGGCGCTCGTCAACGGCACC
CAGGCCATGTGCGCGGTGGGCACCCTGCTCCAACTGCGCGCCGAGATGCTGGCGGACTTG
GCGGACCTGGCCGGGGCGATGACCCTGGAGGGGCTGCTGGGCAGCCACAAGCCCTTCATT
CCGGAGATCCAGGACGTGCGCGCCCACGAAGGCCAGAAGGCCTGCGCCGCCCACTTGCGC
GAGTTGCTGGCGGACAGCGCACTGGTGGAGAGCCACGTGAACTGCAGCAAGGTCCAGGAC
CCCTACAGCCTGCGCTGCATGCCCCAAGTGCACGGCGCGGCGCGCGAGGGGCTGTCCTTT
GCGCGGCGCATCCTGGAAGTGGAAATCAACAGCGCTACGGACAACCCCCTGGTGTTCGTG
GAGACGGAGCGCATCGTCTCGGGCGGCAACTTCCATGGCCAGCCGGTGTCCCTGGCGCTG
GACGTGGCGGCCATGGCGCTCACGCAACTGTCGGCCATCAGCGAGCGCCGCGTGGAGCAA
CTCGTCAACCCAGCGCTGTCGGGGCTGCCGCCGTTCCTTGCGAAGAATTCGGGGCTCAAC
TCGGGCTTCATGATTGCCCAGGTGACGAGCGCCGCGCTGGTGGCCGAATCCCGCGTGCTC
AGCCACCCCGCCTCGGTGGACTCCATCCCCTCCTCCGCAGGGCGAGAGGACCACGTCTCC
ATGGGCATGACAGCGGCGCTCAAGGGCCGTCAGGTGGCCGACTTCACCCGCTCGTGCCTC
GCCATCGAACTGCTGGTGGCGGCCCAGGCACTGGACTACCGCCAGCCCACCCGGGCGGGA
AAAGGCCCGCAGGCGGCGTACGAGCTCATCCGGAGCAAGATTCCCACCATGGAAAAGGAC
CGGGAGCTGCACCGGGATATCGCAGCCGTGAGCGCGCTCATCGACTCAGGTGAGCTGCTG
AACGCTGTGCGCACCGCGACGCGCGGACAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001106 Aromatic amino acid lyase (Family)
 [7-478]  PF00221
PF00221   Lyase_aromatic
IPR005921 Histidine ammonia-lyase (Family)
 [7-506]  TIGR01225
TIGR01225   HutH
IPR008948 L-Aspartase-like (Domain)
 [2-509]  SSF48557
SSF48557   L-Aspartase-like
IPR022313 Phenylalanine/histidine ammonia-lyases, active site (Active_site)
 [141-157]  PS00488
PS00488   PAL_HISTIDASE
IPR024083 L-Aspartase-like, N-terminal (Domain)
 [4-199]  5.69999999999998e-83 G3DSA:1.10.275.10
G3DSA:1.10.275.10   G3DSA:1.10.275.10
SignalP No significant hit
TMHMM No significant hit