close all open/close all

CDS information : Myxa_00030


close this sectionLocation

Organism
StrainSga15
Entry nameMyxalamid
Contig
Start / Stop / Direction7,822 / 3,275 / - [in whole cluster]
7,822 / 3,275 / - [in contig]
Locationcomplement(3275..7822) [in whole cluster]
complement(3275..7822) [in contig]
TypeCDS
Length4,548 bp (1,515 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)MxaA
Gene
Gene (GenBank)mxaA
EC number
Keyword
  • alanine
Note
Note (GenBank)
  • non-ribosomal peptide synthetase; contains a condensing, adenylation, and PCP reductase domains
Reference
ACC
PmId
[11182319] Novel features in a combined polyketide synthase/non-ribosomal peptide synthetase: the myxalamid biosynthetic gene cluster of the myxobacterium Stigmatella aurantiaca Sga15. (Chem Biol. , 2001)
[26235055] Comprehensive Structural and Biochemical Analysis of the Terminal Myxalamid Reductase Domain for the Engineered Production of Primary Alcohols. (Chem Biol. , 2015)

close this sectionPKS/NRPS Module

8
C73..372
A563..956
PCP1042..1109
R1150..1509

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [MxaA]
MSVRELLTTLAAKGVRLRLEGDKLQVEASKAVLTPELRAELSANKADILAFLRKHSSREE
TGSELGQPLARPEVIPLSSGQERLWFLDRLSPGTSQYNVHLGLRARGALDTKALRRSLDE
LVRRHEVLRTHFPEVEGSPRQVIVSPDTGVALTIVELPGLTESQREEEIYRRSDELAQQP
FDLAKGPLLRVTVLALGPDDFALFVTKHHIITDGWSLGVFVRELSMLYASFVRGQAAALP
PVSMQFADSALRERAWLAGESGARERAYWKGKLKGLPPLQLPVDHAVSTSTSHRGATVPL
ALSPALSDALRELASREGCSFFTVLFAAFSALLHRYSGQVDFGVGTVIANRGSVPADLIG
FIANTLALRCDLSGEPTFSQWLARAHKVVLEALDYQALPFSEVVQTVGASRDGGLNPLVR
ACFTLESIPAPTLDLPGTSWSFLNGAPDGSVEGVAKFELSLILAASEKGLAGMLEYSREV
FDASTVERMVGHFQVLLESIVAHPEVPLSKLPLLTAEERGRLLNDWNGPVLDVPALCMHE
LVQAQAERTPQAVAVVSGQKTLTYAELNRRANQLAHHLRRLGIQKEERVGLCVERTEDIV
IGLLAILKAGGAYVPLDPAYPKERLALILEDAQVPVLLTQQRLVPELPATQARVVCLDKD
WPTIGAESDTNPERITAPEAIAYLIYTSGSTGKPKGVMIEHRNAVAFLIWAMSVFSPKEL
AGTLASTSICFDLSVFEIFTPLCCGAKVIVAKNALELPELPAAREVTLINTVPSAMGALL
RSGGVPSSVAIVNLAGEALAGALVDQIYQLDHVRDVFNLYGPSETTTYSTFTRVNRGQTP
TIGRPVGNTQVYALDSNREPMPIGVPGEVYIGGMGVARGYLGRPELTAERFVRSPFGGGS
EARLYRTGDLARWLPDGQLEYLGRMDHQVKLRGFRIELGEIGAVLMEHSGIRDAVVVVRE
GLGADKQLVAYVVGRGEKAPEPAELRDYLKSKLPEYMVPFLFVGLDALPLTPNGKVDRAA
LPAPERTHSGPAKEHVAPRTPGEESLAAIWRQVLGVEQIGAHDNFFELGGHSLLLYRVLV
LARSASGADIPLRALLQAPTLEEMARAVEAAKTGSLPAHDVTVEMEADAVLDAEIALGKA
LPPVTGALRTILLTGATGFLGAFLLEELCRRTDARIYCLVRSKTEQEGMNRIRKNLESYS
LWNEALAPRIVPVRGDIGQPLLGLSEKEFQRLSEEIDAIYHNGALVNFLYPYESMRAANV
LGTREILRLATRTRIKPLHYVSTVSVLPLGRKAPIREDEPLEGPSSLVGGYAQSKWVAEK
LVREASRRGLPVTILRPGRVTGHSRTGAWNTDDLVCRTLKGCVRMGVAPSVDALLDLTPV
DYVSSAIVDLSMRPESIGQTYHLVNPQFVRADEMWNYMRAFGYGLRVLPYDQWLSELGSA
ASSDSELGDLLMFLQQVPPEDRSVGGPRMVVCDSGDTLKALGGTGTSCPSVDASLISTYL
SSLVHRGFLKAPEVR
selected fasta
>non-ribosomal peptide synthetase [MxaA]
ATGAGTGTACGAGAGTTGTTGACCACCCTGGCGGCCAAGGGCGTGCGCCTGCGTCTCGAA
GGGGACAAGCTCCAGGTCGAGGCAAGCAAGGCCGTCCTCACCCCGGAACTGCGCGCCGAG
CTGTCCGCGAACAAGGCAGACATCCTGGCGTTCTTGCGGAAGCACTCCTCGCGGGAAGAG
ACGGGGAGCGAGCTGGGACAGCCCCTCGCGAGGCCGGAGGTCATCCCGCTGTCCAGCGGG
CAGGAGCGGCTCTGGTTCCTTGATCGCCTTTCGCCGGGGACGTCGCAGTACAACGTCCAT
CTCGGCCTCCGTGCGCGGGGGGCGCTCGATACCAAGGCCCTGCGCCGGAGCCTGGATGAG
CTCGTCCGGCGGCACGAGGTGCTCCGGACGCATTTCCCGGAGGTTGAGGGAAGCCCCCGG
CAGGTCATCGTGTCTCCCGATACGGGCGTGGCGCTGACGATCGTGGAACTACCGGGGCTC
ACGGAATCGCAGCGCGAGGAAGAGATCTATCGGCGCTCGGACGAGCTGGCGCAGCAGCCC
TTCGATTTGGCGAAGGGCCCGCTTCTCCGGGTGACGGTCCTGGCCTTGGGGCCCGACGAC
TTCGCCCTCTTCGTGACGAAGCACCACATCATCACGGACGGCTGGTCGCTCGGCGTCTTC
GTCCGAGAGCTGTCGATGCTGTACGCTTCCTTTGTCCGGGGGCAGGCGGCGGCCCTGCCG
CCCGTGTCGATGCAGTTCGCCGATTCGGCCTTGCGCGAGCGTGCGTGGCTGGCAGGGGAG
TCAGGTGCTCGCGAGCGAGCGTACTGGAAGGGGAAGCTCAAGGGGCTGCCCCCGCTTCAG
CTCCCCGTGGACCATGCGGTTTCCACCTCGACGAGTCATCGCGGTGCCACCGTTCCCCTC
GCATTGTCACCAGCGCTCAGCGATGCCTTGCGAGAGCTCGCCAGCCGAGAGGGGTGCAGC
TTCTTCACGGTGCTCTTCGCCGCGTTCTCGGCACTTCTGCACCGCTACTCCGGGCAGGTG
GATTTCGGTGTCGGGACGGTGATCGCCAACCGTGGGAGCGTGCCCGCGGACCTCATTGGC
TTCATTGCCAATACCCTCGCGCTTCGGTGTGACCTGTCGGGTGAGCCGACCTTTTCGCAG
TGGCTGGCCCGTGCCCATAAGGTTGTGCTCGAGGCGCTGGACTACCAAGCACTGCCGTTC
AGCGAGGTGGTTCAGACGGTCGGCGCGTCGCGCGATGGTGGGCTCAACCCGCTGGTGCGG
GCCTGCTTTACGCTGGAGAGCATTCCTGCGCCGACGCTGGATCTGCCGGGAACGAGCTGG
TCATTCCTGAATGGCGCTCCGGATGGCAGTGTGGAGGGGGTCGCCAAGTTCGAACTCTCG
CTCATCCTGGCCGCAAGCGAAAAAGGCTTGGCGGGCATGCTTGAGTACTCGCGGGAGGTT
TTTGACGCCTCGACGGTGGAGCGGATGGTGGGGCACTTCCAGGTGCTGCTCGAGTCCATC
GTGGCCCATCCGGAGGTGCCGCTGTCGAAGCTGCCGCTGTTGACTGCGGAAGAGCGTGGA
AGGCTCCTCAACGATTGGAACGGTCCTGTGCTCGATGTCCCGGCGCTGTGCATGCACGAA
CTCGTGCAGGCCCAGGCCGAGCGGACCCCCCAGGCCGTGGCCGTGGTGAGCGGGCAGAAG
ACCCTCACCTATGCCGAGCTCAATCGCCGGGCGAACCAACTGGCCCATCATCTGCGGCGG
CTCGGAATACAGAAGGAGGAGCGTGTCGGCCTCTGCGTCGAGCGCACGGAAGACATCGTC
ATCGGACTGCTGGCGATCCTCAAGGCAGGGGGCGCCTACGTCCCGCTGGATCCCGCCTAT
CCGAAGGAGCGCTTGGCGCTGATTCTGGAGGATGCCCAGGTGCCCGTGCTGCTTACACAG
CAGCGCCTCGTTCCGGAACTCCCTGCCACGCAGGCGCGCGTGGTGTGTCTGGACAAGGAT
TGGCCGACCATTGGGGCCGAGAGCGACACGAACCCCGAGCGCATCACGGCGCCGGAGGCG
ATCGCCTATCTCATCTACACCTCGGGCTCCACCGGCAAGCCCAAGGGCGTCATGATCGAG
CACCGCAACGCCGTGGCCTTCTTGATATGGGCCATGAGCGTTTTCTCTCCGAAAGAACTG
GCGGGGACGCTGGCTTCGACGTCGATCTGTTTCGACTTGTCGGTCTTCGAGATCTTTACC
CCTCTGTGCTGTGGGGCGAAGGTGATCGTCGCGAAGAATGCGCTGGAACTGCCAGAGCTG
CCTGCGGCGCGGGAGGTGACGCTCATCAACACCGTTCCATCGGCCATGGGCGCGCTGCTG
CGTTCGGGCGGCGTGCCGTCCTCGGTGGCCATCGTCAACCTGGCGGGTGAAGCCCTCGCG
GGGGCACTCGTCGATCAGATCTACCAGCTCGACCACGTGAGGGATGTGTTCAACCTCTAT
GGCCCGAGCGAGACCACGACCTATTCGACGTTCACCCGGGTGAACCGTGGGCAGACGCCG
ACCATTGGGCGCCCCGTCGGAAACACGCAGGTGTACGCGCTGGATTCGAACAGGGAGCCG
ATGCCCATCGGTGTGCCGGGCGAGGTTTACATTGGTGGCATGGGGGTCGCGCGAGGGTAC
TTGGGCCGACCGGAGCTCACGGCGGAGAGGTTTGTCCGCTCTCCCTTTGGTGGAGGCTCC
GAGGCGCGCCTGTACAGGACCGGAGACCTGGCGAGGTGGCTGCCTGATGGGCAGCTCGAG
TACCTGGGCCGGATGGATCACCAGGTGAAACTGCGTGGCTTCCGCATCGAGTTGGGAGAG
ATCGGCGCGGTGCTGATGGAGCATTCCGGCATCCGCGATGCCGTGGTCGTGGTGCGGGAG
GGACTGGGGGCGGACAAGCAACTCGTGGCGTACGTGGTCGGGCGTGGGGAGAAGGCGCCC
GAACCGGCCGAGTTGCGCGACTACCTGAAGTCCAAGTTGCCCGAGTACATGGTTCCCTTC
TTGTTCGTGGGCCTGGACGCGCTGCCGCTCACTCCGAACGGAAAGGTGGATCGTGCCGCG
CTCCCAGCGCCGGAACGCACTCACTCCGGACCGGCGAAGGAGCACGTCGCGCCGAGGACT
CCTGGGGAAGAGTCCCTGGCCGCCATTTGGCGCCAGGTCTTGGGCGTGGAGCAGATCGGT
GCCCACGACAACTTCTTCGAACTCGGAGGACACTCACTGCTGTTGTACCGGGTGCTCGTC
CTCGCCCGTTCGGCGTCTGGTGCGGACATTCCGCTGCGAGCCCTGCTGCAGGCACCGACC
CTGGAGGAGATGGCTCGGGCTGTCGAGGCCGCGAAGACAGGCTCGCTGCCAGCCCACGAT
GTGACGGTGGAGATGGAAGCAGATGCTGTGCTGGATGCCGAGATCGCGCTGGGCAAGGCA
CTTCCGCCCGTGACGGGGGCTTTGCGCACCATCCTGCTGACCGGCGCCACGGGCTTCCTC
GGTGCTTTCTTGCTGGAGGAACTCTGCCGCAGGACGGACGCGCGCATTTATTGCTTGGTG
CGCTCCAAGACAGAGCAGGAGGGGATGAACAGGATTCGCAAGAACCTGGAGAGCTACTCC
CTGTGGAACGAGGCTCTGGCGCCTCGCATCGTTCCTGTCCGAGGAGATATTGGCCAACCG
TTGTTGGGACTCTCGGAGAAGGAGTTCCAGCGGCTCTCGGAAGAGATTGACGCCATTTAT
CACAATGGCGCGCTCGTCAATTTCCTCTACCCCTACGAGTCCATGCGAGCGGCCAACGTG
CTTGGCACGCGGGAGATCCTCCGGCTGGCTACGCGGACGCGCATCAAACCGTTGCACTAC
GTTTCGACTGTTTCGGTATTGCCCCTGGGACGAAAGGCTCCGATCCGCGAGGATGAGCCT
TTGGAAGGGCCCTCAAGTTTGGTGGGAGGCTACGCACAGAGCAAGTGGGTTGCCGAGAAG
CTTGTGAGAGAGGCTTCTCGGCGGGGGCTCCCGGTGACCATCCTCCGGCCGGGACGGGTG
ACCGGCCACAGCCGCACGGGGGCCTGGAACACGGACGATCTGGTGTGCAGGACCCTCAAG
GGGTGCGTCCGGATGGGAGTGGCTCCCAGCGTCGATGCGCTGCTTGACCTGACGCCCGTC
GATTACGTCAGCAGTGCCATCGTGGATCTGTCCATGCGCCCGGAGTCGATTGGCCAGACG
TATCATCTCGTCAATCCGCAGTTCGTGCGCGCTGATGAGATGTGGAATTACATGCGAGCC
TTTGGGTACGGATTGCGAGTCCTCCCGTATGACCAATGGCTTTCGGAATTGGGCTCCGCG
GCATCGTCCGACAGCGAGCTGGGCGATCTTCTCATGTTCCTCCAGCAGGTTCCTCCAGAG
GACCGGAGCGTTGGCGGACCGCGGATGGTGGTTTGCGACAGTGGCGACACGCTGAAGGCC
TTGGGAGGAACGGGAACGTCCTGCCCGTCGGTGGACGCCTCTTTGATTTCAACCTACCTC
TCGTCGCTCGTTCACCGCGGCTTTCTCAAGGCACCCGAGGTGAGGTGA
[8] C73..372
[8] A563..956
[8] PCP1042..1109
[8] R1150..1509
[8] C217..1116
[8] A1687..2868
[8] PCP3124..3327
[8] R3448..4527

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [563-956]  5.20000000000001e-115 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [73-372]  1.2e-64 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [1035-1110]  2.800005042611e-19 SSF47336
SSF47336   ACP_like
 [1045-1108]  2.7e-13 PF00550
PF00550   PP-binding
 [1042-1109]  PS50075
PS50075   ACP_DOMAIN
 [1033-1112]  2.2e-25 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [563-956]  TIGR01733
TIGR01733   AA-adenyl-dom
IPR010080 Thioester reductase (Domain)
 [1150-1509]  TIGR01746
TIGR01746   Thioester-redct
IPR013120 Male sterility, NAD-binding (Domain)
 [1153-1387]  7.5e-77 PF07993
PF07993   NAD_binding_4
IPR016040 NAD(P)-binding domain (Domain)
 [1150-1376]  2.1e-34 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020845 AMP-binding, conserved site (Conserved_site)
 [684-695]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit