close all open/close all

CDS information : Myxa_00040


close this sectionLocation

Organism
StrainSga15
Entry nameMyxalamid
Contig
Start / Stop / Direction11,520 / 7,819 / - [in whole cluster]
11,520 / 7,819 / - [in contig]
Locationcomplement(7819..11520) [in whole cluster]
complement(7819..11520) [in contig]
TypeCDS
Length3,702 bp (1,233 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)MxaB1
GenemxaB2
Gene (GenBank)mxaB1
EC number
Keyword
Note
Note (GenBank)
  • PKS; ketosynthase; acyltransferase
Reference
ACC
PmId
[11182319] Novel features in a combined polyketide synthase/non-ribosomal peptide synthetase: the myxalamid biosynthetic gene cluster of the myxobacterium Stigmatella aurantiaca Sga15. (Chem Biol. , 2001)

close this sectionPKS/NRPS Module

7
DH8..180
er
KR848..1028
ACP1124..1197

close this sectionSequence

selected fasta
>polyketide synthase [MxaB1]
MRAGAGGHPLLGVSFTTSVQKENRFWESALSAKEPSYLADHRVGGAVVVPGAAYLEMALS
AARELSGEKAYELVDTSFKEGLLLPEGQERVVQMALSGEGGDALSFQLSSQKASTEPNAP
AGWMAHVVGQIRPIEGGPSTQTPESFEAIRERCSEVIAQAAHYEELASRGVAYGPAFQGV
QQIWRGRAEALGHVRLPEPLAARASAYRIHPALLDACFQLVAAAVPQEDLTPDAGPAVPV
ALAHLRLHEQPGTEVFCHVRLRPSEGARRGVYEFDLVLRDASGRILVEALGLRVQQLDAP
AAEHAGKDLFFALEWRHASAVQQVPAEGPGASGRWLLIADGSELADTVESQLRERHGEVI
RVDLAGAGQGRRVVDATSPQAFDGVLSEAFGAGSAPRGVIHLTGLEPREVDPIMGCGGVL
HLVQALSRVSLASPPRLWLVTRGVHHGSGSRSASDVVQASLWGLGRTLAHEHSELKCTRV
DVSAAMGTGDAGAALMRELLVADDEEEISLRADGRHVGRIVRGSPGRAPSEAVVPAGGRP
FHLERDAQGRLEFRAGARRPPGPGELEIEVEVAALGGPGEGTGPERWEGAGEGIGCSGRV
VAIGEGVKNVAVGEERIALVASGLGSHVSVPAGCTAIRPSSSSHGEAAALAATVLPAWYA
LFHLGRLEKRGRVWVLGATSGLGRAAIKLAKRAGAEVFAVATTDEQRASLRELGADQVMD
PSDASFVSRVLDATGGRGVELAIVAPGAVELERSLPTLSEGARVLDLRASGASARTGDAN
VAWCVVDVQDFARRRPERFASLWQEVKAAFEAGGLPSAAADAKALALKDPKARVVVPAAD
ARRLRADGTYLVTGGLGGLGLAVAKWMVEQGAGHLVLVGRDTVLSPEQQEVVTALEAAGA
RVRVARADVSDRAQIARILSEIAEGGAPLRGVIHAAGVLDDGVLLQQTVERFRRVMAPKV
LGGWNLHVLTREAPLDFFVLYSSAASMFGAPGQGNYVAGNAFLDALAHHRRALGLPGLSI
NWGPFSEVGLAAAQANRGERLAQRGSDSLTPAEGNTILGRLLDGDVTQMAVMPLELRKWV
EFYPRAKSSPWLSELVPADAGQEVGEARDVALLETLRTATPQEAKAALEQFVREQLARVL
RLDSARIDPEAPLQSFGLDSLMGLELRNRLVSGLGVSLPASLIWKHPTLAALCAHLLGEV
MDRTLAETLAQAAAGAGPAVDESAADDKEVFVL
selected fasta
>polyketide synthase [MxaB1]
GTGCGCGCTGGCGCGGGAGGTCATCCCCTCCTAGGAGTTTCGTTCACGACTTCTGTCCAG
AAGGAGAATCGGTTCTGGGAGTCCGCACTGAGCGCCAAGGAGCCCTCGTATCTGGCGGAT
CACCGCGTGGGTGGGGCGGTGGTAGTGCCGGGTGCGGCTTATCTGGAGATGGCGTTGTCG
GCGGCTCGGGAGCTGTCCGGCGAGAAGGCATACGAACTCGTCGACACCTCCTTCAAAGAG
GGGTTGCTGCTGCCTGAGGGGCAGGAGCGCGTGGTCCAGATGGCGCTGAGCGGTGAGGGT
GGGGACGCCCTCTCGTTCCAGCTCTCGAGCCAGAAGGCGAGCACGGAGCCGAACGCTCCG
GCGGGCTGGATGGCCCATGTCGTAGGCCAGATTCGCCCCATCGAGGGAGGGCCGTCGACG
CAGACGCCCGAGTCATTCGAGGCGATCCGGGAACGGTGCTCCGAGGTGATCGCCCAGGCG
GCGCATTACGAGGAACTGGCGAGCCGTGGGGTGGCCTACGGACCGGCGTTCCAGGGCGTG
CAGCAGATATGGCGTGGTCGGGCGGAAGCGCTCGGACATGTGCGCCTGCCAGAGCCGCTC
GCGGCGAGGGCTTCGGCGTATCGAATCCATCCTGCGTTGCTCGATGCGTGCTTCCAGTTG
GTGGCCGCGGCCGTTCCCCAGGAAGATCTCACTCCTGACGCTGGTCCTGCTGTGCCTGTG
GCGCTCGCCCACCTGCGGCTTCACGAACAGCCTGGGACAGAGGTCTTCTGTCACGTGCGG
CTGAGGCCGTCGGAGGGCGCGCGGCGCGGTGTTTACGAGTTCGATCTCGTGTTGCGCGAT
GCATCTGGCCGGATCCTGGTGGAGGCACTCGGGCTGCGTGTTCAGCAACTGGATGCTCCG
GCTGCGGAGCACGCCGGGAAGGATCTCTTCTTCGCGCTCGAATGGCGGCATGCATCCGCT
GTGCAGCAGGTTCCTGCTGAGGGCCCTGGTGCAAGCGGGCGCTGGCTGCTCATCGCTGAC
GGCAGCGAGCTTGCCGACACGGTCGAATCTCAACTGCGAGAGCGCCATGGAGAGGTGATC
CGTGTCGATCTGGCGGGAGCGGGCCAGGGGCGCCGAGTCGTGGATGCAACCTCGCCTCAA
GCGTTCGACGGTGTGCTGTCGGAGGCGTTCGGCGCGGGTTCGGCTCCTCGAGGAGTGATC
CACTTGACCGGGCTGGAGCCCCGCGAGGTGGATCCGATCATGGGGTGCGGCGGTGTGCTG
CATCTCGTGCAGGCGCTCTCCCGGGTGAGCCTGGCGAGCCCTCCCAGGTTGTGGCTCGTC
ACGAGAGGCGTCCATCATGGCTCTGGCAGTCGGTCGGCCTCCGATGTGGTGCAGGCATCG
CTGTGGGGCCTGGGTCGCACGCTGGCGCACGAGCACTCCGAACTGAAGTGCACGCGCGTG
GATGTGTCCGCAGCCATGGGGACGGGAGATGCTGGAGCAGCGCTGATGCGCGAGCTGCTC
GTGGCTGATGATGAGGAGGAGATCTCCCTTCGTGCGGATGGCCGCCATGTCGGCCGTATC
GTGCGCGGCTCACCCGGAAGGGCCCCCAGCGAGGCCGTGGTTCCGGCGGGGGGACGACCC
TTCCACCTGGAGCGCGACGCGCAGGGCCGGTTGGAGTTCAGAGCGGGCGCACGGCGTCCA
CCTGGGCCAGGGGAGCTCGAGATCGAAGTCGAGGTGGCTGCACTGGGAGGTCCCGGCGAG
GGGACCGGACCGGAGCGGTGGGAGGGCGCGGGGGAGGGCATCGGGTGCAGTGGGCGGGTC
GTGGCCATTGGCGAGGGAGTGAAGAACGTCGCGGTGGGTGAGGAGCGGATTGCCCTGGTG
GCATCGGGCCTGGGTTCCCACGTGAGTGTTCCCGCCGGGTGCACGGCCATTCGCCCGTCG
TCGTCGTCGCACGGGGAAGCCGCGGCGCTTGCAGCGACCGTTCTGCCTGCTTGGTACGCG
CTGTTCCACTTGGGACGTCTTGAGAAGCGGGGCCGCGTGTGGGTCCTCGGAGCCACCAGC
GGGCTTGGGCGTGCCGCGATCAAACTGGCCAAGAGGGCAGGGGCGGAGGTCTTCGCTGTT
GCCACGACGGACGAGCAGCGGGCGTCTCTGCGGGAACTCGGCGCAGATCAGGTCATGGAT
CCGAGCGATGCTTCGTTCGTGTCCCGAGTTCTGGATGCGACGGGGGGACGAGGGGTGGAG
TTGGCCATTGTCGCGCCGGGCGCTGTCGAACTCGAGCGGAGCTTGCCCACGCTGAGCGAG
GGGGCTCGTGTCCTCGACCTGCGTGCGTCGGGAGCGTCGGCCCGTACCGGGGATGCCAAC
GTCGCTTGGTGCGTGGTGGACGTGCAGGATTTCGCGCGCCGCAGGCCCGAGCGGTTTGCC
AGCCTCTGGCAGGAAGTGAAGGCCGCATTCGAGGCGGGAGGACTGCCGTCCGCGGCGGCG
GATGCGAAGGCGCTGGCGCTGAAGGATCCCAAGGCGCGTGTTGTGGTGCCCGCAGCGGAT
GCCCGACGGCTTCGCGCCGATGGGACCTACCTCGTTACGGGTGGGCTCGGTGGGCTCGGT
CTCGCGGTGGCGAAGTGGATGGTCGAGCAGGGCGCGGGCCATCTGGTGCTCGTTGGACGC
GACACCGTCCTGTCACCTGAGCAGCAGGAAGTGGTGACCGCGCTCGAGGCTGCTGGGGCA
CGGGTGCGGGTGGCCCGGGCCGACGTGTCTGATCGGGCGCAGATCGCCCGGATCCTCTCG
GAGATCGCGGAGGGCGGCGCTCCGCTGAGAGGCGTCATCCACGCGGCGGGTGTGCTGGAC
GATGGCGTCCTGTTGCAGCAGACGGTGGAGCGGTTCCGCCGCGTGATGGCCCCCAAGGTT
CTCGGTGGCTGGAACCTGCATGTCCTGACGCGCGAGGCGCCGCTCGACTTCTTCGTTCTG
TATTCGTCGGCGGCCTCGATGTTCGGCGCACCAGGACAAGGCAACTATGTGGCCGGCAAC
GCCTTCCTCGATGCGCTCGCCCACCACCGCCGGGCGCTTGGGTTGCCCGGTTTGAGCATC
AACTGGGGGCCTTTCTCGGAGGTCGGTCTGGCCGCGGCTCAAGCCAACCGGGGCGAGCGT
CTTGCCCAGCGGGGCTCGGACAGCCTGACGCCTGCGGAAGGAAACACGATCCTCGGCCGA
CTGCTCGATGGCGATGTGACCCAGATGGCGGTCATGCCGCTCGAGCTTCGCAAGTGGGTG
GAGTTCTATCCTCGTGCGAAGTCGTCTCCCTGGCTGTCGGAGTTGGTCCCGGCGGACGCG
GGCCAGGAAGTGGGCGAAGCGCGGGATGTGGCCCTGCTCGAAACGCTGCGGACGGCAACT
CCGCAGGAGGCGAAGGCGGCCCTGGAGCAGTTTGTCCGAGAGCAGTTGGCCCGGGTTCTC
CGTTTGGACTCCGCGCGCATCGATCCGGAAGCACCGCTCCAGAGCTTTGGTCTCGACTCC
CTGATGGGACTCGAATTGCGCAACCGTCTGGTATCGGGGCTGGGGGTGTCATTGCCTGCT
TCGTTGATCTGGAAGCACCCGACTCTGGCCGCGCTCTGCGCGCATCTCCTGGGTGAAGTC
ATGGATCGCACCCTGGCTGAGACGCTCGCTCAGGCGGCTGCGGGTGCTGGACCGGCGGTG
GATGAGTCCGCCGCTGACGATAAAGAGGTCTTTGTCCTATGA
[7] DH8..180
[7] KR848..1028
[7] ACP1124..1197
[7] DH22..540
[7] KR2542..3084
[7] ACP3370..3591

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [1155-1170]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1127-1200]  2.2e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1131-1196]  1.1e-12 PF00550
PF00550   PP-binding
 [1121-1218]  6.79998707392904e-20 SSF47336
SSF47336   ACP_like
 [1124-1197]  PS50075
PS50075   ACP_DOMAIN
IPR011032 GroES-like (Domain)
 [551-677]  5.7999965385478e-13 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [681-765]  2.2e-16 PF00107
PF00107   ADH_zinc_N
IPR013968 Polyketide synthase, KR (Domain)
 [848-1027]  3.79999999999991e-74 PF08659
PF08659   KR
IPR016040 NAD(P)-binding domain (Domain)
 [639-815]  3.60000000000002e-34 G3DSA:3.40.50.720 [847-1064]  3.29999999999997e-47 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1129-1200]  2.60000517657733e-27 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [8-180]  7.20002719778969e-50 SM00826
SM00826   PKS_DH
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [848-1028]  1.59998835313644e-66 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit