close all open/close all

CDS information : Myxa_00050


close this sectionLocation

Organism
StrainSga15
Entry nameMyxalamid
Contig
Start / Stop / Direction14,303 / 11,487 / - [in whole cluster]
14,303 / 11,487 / - [in contig]
Locationcomplement(11487..14303) [in whole cluster]
complement(11487..14303) [in contig]
TypeCDS
Length2,817 bp (938 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)MxaB2
GenemxaB1
Gene (GenBank)mxaB2
EC number
Keyword
Note
Note (GenBank)
  • PKS; dehydratase; enoylreductase; ketoreductase; ACP
Reference
ACC
PmId
[11182319] Novel features in a combined polyketide synthase/non-ribosomal peptide synthetase: the myxalamid biosynthetic gene cluster of the myxobacterium Stigmatella aurantiaca Sga15. (Chem Biol. , 2001)

close this sectionPKS/NRPS Module

7 methylmalonyl-CoA
not conserved YASHS(Y->V)
KS37..413
AT569..879

close this sectionSequence

selected fasta
>polyketide synthase [MxaB2]
MSKQEKPAEQPSALQRAALLVEKMQARLDAVERARTEPIAVIGLGCRFPGGAVDGSSYWK
ILRDGVDALREVPESRWDVPGHFDSTRGVPGKMYGTRGGFLDDVEHFDAEFFGISPREAA
SLDPQQRLVLEVAWEALENAGLAPDQLAGSKTGVFMGVMSSDYMARLLKENDATRFDGYM
ATGNGYSFVPGRVSYVLGLQGPCMPVDTACSSSLVALHLASESLRAGESNLALAGGVNLI
LSPETMICLCSMQALASDGRCKTFDASADGYVRGEGCGVLVLKRLSDAQRDGDSILALIR
GSAVNHDGASGGLTVPNGPSQQAVVQRALDNARIAPALVGYIEAHGTGTPLGDPIELRAL
GAVLGKGRPADRPFFIGSVKTNIGHLEPAAGIAGVIKTILSLQHKEIPPHLHFRTPNPHV
EWDRIPARVPVERVPWPAHEGRRIAGVSSFGLSGINAHVVLEEAPASTAPTAVAEEDKAQ
LVVLSAKTPRALSSLAEAWSSFLKNEEGGSLADISYTSALSRTPHEHRLALAAKSKQELI
EQLEAFAAGKSHAGLSSGRRGTGLGQKIVFVFPGQGSQWLGMGQRLYAENVTFREAIDWC
HEAISRYTDWSLRDLLTNPGQQPRWNDIDVIQPTLFALQVALAAVWRWLGLEPHAVVGHS
MGEVAAAHVAGALSLEDAARIICERSKLLRRVSGQGAMAVVDLSREQAEVEIRGAEDRIA
IAVSNGPRSTVLSGDPAALKEVLERLERREVFCRWVKVDVASHSPQMDPLRQDLLDRMAA
IRPTGSAVPLYSTVTGAPIDGRELSAPYWVRNLRQPVLFADAVQRLIQDGNVLFIELSPH
PILVPFVDAMLREGDTSGRGLVVPSLIRDQEEWPSLLSSVGALFTRVIAWTGSGYIPTSV
AGLRFLRTRGSASGTGWSCQQLRRRAGSCALAREVIPS
selected fasta
>polyketide synthase [MxaB2]
ATGAGCAAGCAGGAAAAGCCAGCCGAGCAGCCCTCCGCGCTTCAGCGCGCCGCGCTGCTC
GTGGAGAAGATGCAGGCGCGCCTTGATGCGGTGGAGCGCGCTCGGACCGAGCCGATCGCT
GTCATTGGGCTGGGGTGCCGTTTCCCGGGCGGCGCCGTCGATGGATCGTCGTACTGGAAG
ATCTTGCGCGACGGGGTGGATGCGTTGCGCGAGGTGCCCGAGTCTCGTTGGGACGTCCCC
GGCCATTTCGATTCCACCCGCGGAGTTCCCGGCAAGATGTACGGAACCCGGGGCGGCTTC
CTCGACGACGTGGAGCATTTCGATGCCGAGTTCTTCGGCATCTCGCCCCGAGAGGCGGCG
AGCCTGGATCCGCAGCAGCGGCTCGTCCTAGAGGTCGCATGGGAGGCGCTAGAGAACGCG
GGCCTGGCACCCGATCAGCTCGCGGGCAGCAAGACGGGCGTCTTCATGGGCGTGATGTCC
AGCGACTACATGGCGCGCTTGTTGAAGGAGAACGACGCGACCCGCTTCGACGGGTACATG
GCGACGGGCAACGGGTACAGCTTCGTTCCTGGACGTGTCTCCTATGTGCTCGGGCTGCAG
GGGCCGTGCATGCCGGTCGACACCGCATGCTCGTCCTCGCTGGTCGCGCTTCACCTGGCG
AGCGAGAGCCTCCGGGCAGGGGAGTCCAACCTGGCGCTGGCGGGCGGGGTCAACCTGATC
CTCTCGCCGGAGACGATGATCTGCTTGTGCAGCATGCAGGCGCTCGCGAGCGATGGCCGG
TGCAAGACGTTCGATGCATCGGCCGACGGGTACGTGCGAGGCGAGGGGTGTGGCGTCCTC
GTGCTCAAGCGGCTCTCGGATGCGCAGCGCGATGGAGACTCCATCCTCGCGCTGATCCGC
GGCTCAGCCGTCAACCATGACGGGGCCAGCGGAGGGCTGACCGTGCCCAACGGCCCGTCG
CAGCAGGCAGTCGTGCAGCGGGCGCTCGACAACGCGCGCATCGCCCCGGCCCTCGTGGGT
TACATCGAGGCACATGGTACCGGTACGCCGCTCGGGGACCCGATCGAGCTTCGGGCGCTC
GGTGCCGTGCTGGGCAAGGGGCGTCCGGCAGACAGACCTTTCTTCATCGGGTCGGTCAAG
ACCAACATCGGGCACTTGGAGCCAGCCGCGGGGATCGCAGGAGTCATCAAGACGATCCTC
TCGCTCCAGCACAAGGAGATTCCCCCCCATCTGCATTTCCGCACCCCCAACCCGCATGTG
GAGTGGGATCGGATTCCGGCGCGGGTTCCCGTCGAGCGTGTTCCCTGGCCGGCCCATGAG
GGACGACGCATCGCTGGCGTGAGTTCCTTCGGTCTGAGCGGGATCAACGCGCACGTGGTG
TTGGAAGAGGCTCCGGCCTCCACCGCCCCCACGGCCGTGGCAGAAGAGGACAAGGCGCAG
CTTGTCGTCCTGTCCGCGAAGACACCCCGGGCGTTGTCTTCCCTGGCGGAGGCATGGAGT
TCGTTCCTGAAGAACGAGGAGGGAGGGTCGCTCGCGGACATCAGTTACACCTCCGCCCTC
AGCCGGACGCCTCACGAGCACCGGCTTGCTCTTGCGGCGAAGTCCAAGCAGGAGCTCATC
GAGCAGCTCGAGGCTTTCGCTGCCGGGAAGAGCCATGCGGGCCTGTCCTCGGGGCGCCGG
GGAACAGGCCTTGGGCAGAAGATCGTCTTTGTCTTTCCGGGCCAGGGCTCTCAGTGGCTC
GGCATGGGACAGAGGCTGTACGCGGAGAACGTCACGTTCCGAGAGGCCATCGACTGGTGC
CATGAGGCGATCAGCCGCTACACCGATTGGTCCTTGCGCGATCTCCTGACGAACCCCGGA
CAGCAGCCCCGCTGGAATGACATCGACGTCATCCAGCCGACGCTGTTCGCCTTGCAGGTG
GCGCTCGCGGCGGTATGGCGTTGGTTGGGTCTAGAGCCCCACGCGGTGGTGGGGCACAGC
ATGGGGGAAGTTGCCGCGGCGCACGTCGCGGGAGCGCTCTCCTTGGAGGACGCTGCGCGC
ATCATCTGCGAGCGGAGCAAGCTGCTCAGGCGCGTCAGTGGCCAGGGGGCCATGGCCGTC
GTGGATCTCTCGCGCGAGCAGGCGGAGGTGGAGATCCGGGGTGCGGAGGATCGCATCGCC
ATCGCCGTCAGCAACGGCCCGAGGTCGACGGTTCTCTCGGGAGATCCGGCTGCGTTGAAG
GAAGTGCTGGAGCGTCTCGAGCGTCGTGAGGTGTTCTGCCGCTGGGTGAAGGTGGATGTG
GCTTCGCACAGCCCGCAGATGGATCCGCTGAGGCAGGATCTGCTGGATCGGATGGCGGCC
ATTCGTCCCACTGGAAGCGCGGTGCCGCTCTACTCCACGGTGACGGGAGCCCCCATCGAT
GGTCGGGAGCTGAGTGCCCCGTATTGGGTGCGCAACCTGCGTCAGCCCGTGTTGTTCGCC
GATGCAGTGCAGCGCCTCATCCAGGACGGAAACGTTCTGTTCATCGAGTTGAGCCCGCAT
CCGATCCTCGTGCCCTTCGTGGATGCGATGCTGCGGGAAGGGGACACGTCCGGGCGGGGA
CTCGTGGTGCCGAGCCTGATCCGGGATCAGGAGGAGTGGCCTTCGCTGCTTTCGTCCGTG
GGCGCACTGTTCACCCGCGTGATCGCGTGGACTGGCTCCGGCTACATCCCAACAAGCGTC
GCCGGGTTGCGCTTCCTGCGTACCCGTGGCAGCGCGAGCGGCACTGGATGGAGCTGTCAG
CAGTTGCGTCGAAGGGCCGGATCGTGCGCGCTGGCGCGGGAGGTCATCCCCTCCTAG
[7] KS37..413
[7] AT569..879
[7] methylmalonyl-CoA not conserved YASHS(Y->V)760..764
[7] KS109..1239
[7] AT1705..2637
[7] methylmalonyl-CoA not conserved YASHS(Y->V)2278..2292

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [566-692]  6.10000000000004e-73 G3DSA:3.40.366.10 [760-878]  6.10000000000004e-73 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [37-288]  2.39999999999997e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-413]  2.29999999999998e-44 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [569-879]  1.10000000000001e-95 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [567-871]  3.89999861795218e-69 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [694-759]  4.60000044330862e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-299]  3.60000000000002e-100 G3DSA:3.40.47.10 [300-466]  6.09999999999996e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [29-412]  1.50000965748778e-104 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [201-217]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [571-870]  8.29994113369276e-117 SM00827
SM00827   PKS_AT
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [39-466]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit