close all open/close all

CDS information : Myxa_00100


close this sectionLocation

Organism
StrainSga15
Entry nameMyxalamid
Contig
Start / Stop / Direction48,435 / 49,295 / + [in whole cluster]
48,435 / 49,295 / + [in contig]
Location48435..49295 [in whole cluster]
48435..49295 [in contig]
TypeCDS
Length861 bp (286 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)putative acetyl transferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[11182319] Novel features in a combined polyketide synthase/non-ribosomal peptide synthetase: the myxalamid biosynthetic gene cluster of the myxobacterium Stigmatella aurantiaca Sga15. (Chem Biol. , 2001)
Related Reference
ACC
P00632
PmId
[3003031] Cloning and expression of Acinetobacter calcoaceticus catBCDE genes in Pseudomonas putida and Escherichia coli. (J Bacteriol. , 1986)
[1158871] Beta-ketoadipate enol-lactone hydrolases I and II from Acinetobacter calcoaceticus. (J Biol Chem. , 1975)
[670169] Homologous amino acid sequences in enzymes mediating sequential metabolic reactions. (J Biol Chem. , 1978)

close this sectionSequence

selected fasta
>putative hydrolase [putative acetyl transferase]
MRKWLVAFWIGATVALTGCSDEPGPLDDPPVLVDHWLTASDGMKLHYLELEGEGTPVVLL
HGFLGTASGTWVAPGFAQALAAAGHRVILLDQRGHGESDKPLEPSAYGEQMVTDVIEMLD
DLKINQAHVGGYSMGGEMTAMLMRRVPERFITAHLGGAGIVETDEALRAAAAALDPKGTD
PEEPRILALFEEATANLPPPDPRVIAAMTEAWAVWGPRPVDLTVIDFPVLTVNGEFDNPY
SKTLRMTRELSQFENVVVPRRSHLTTLIDPLYLQSLVAFIDTHDPR
selected fasta
>putative hydrolase [putative acetyl transferase]
ATGCGGAAGTGGCTCGTAGCGTTCTGGATAGGTGCAACCGTGGCACTCACCGGCTGTTCT
GACGAGCCGGGCCCTTTAGATGATCCACCCGTCCTTGTCGATCACTGGTTGACCGCCAGC
GATGGGATGAAGTTGCACTATCTGGAGCTTGAAGGAGAAGGCACACCCGTCGTGCTTCTG
CACGGATTCTTGGGAACAGCGAGCGGAACCTGGGTCGCTCCAGGCTTCGCACAAGCCCTG
GCGGCGGCAGGGCACCGGGTCATTCTCCTCGACCAACGCGGCCACGGTGAGAGTGACAAA
CCCCTCGAGCCTTCGGCCTACGGGGAGCAAATGGTCACCGATGTCATCGAAATGCTGGAC
GATTTGAAAATCAACCAAGCCCACGTGGGTGGCTACTCCATGGGCGGAGAAATGACAGCC
ATGCTGATGAGACGGGTGCCGGAGAGATTCATCACCGCCCATCTCGGGGGGGCGGGCATT
GTGGAAACCGACGAGGCGCTCAGGGCCGCGGCCGCAGCATTGGATCCAAAAGGGACGGAT
CCCGAAGAGCCTCGGATCCTGGCCCTCTTTGAAGAGGCCACGGCGAACCTGCCCCCACCG
GATCCCCGTGTGATCGCAGCCATGACCGAGGCCTGGGCGGTCTGGGGGCCCCGGCCCGTC
GATCTGACCGTCATCGACTTTCCCGTACTGACCGTGAACGGCGAATTCGACAATCCCTAC
TCGAAGACCCTGCGGATGACGCGCGAATTAAGCCAATTCGAGAATGTCGTCGTACCGCGC
CGCTCACATCTCACAACCCTCATCGATCCGCTCTATCTTCAGAGCCTCGTGGCATTCATC
GACACCCACGATCCCCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-19]  0.997 Signal
Eukaryota   
 [1-20]  0.798 Signal
Bacteria, Gram-negative   
TMHMM No significant hit