close all open/close all
Myxa_00100 Myxa_00100   last last

CDS information : Myxa_00110


close this sectionLocation

Organism
StrainSga15
Entry nameMyxalamid
Contig
Start / Stop / Direction49,736 / 49,377 / - [in whole cluster]
49,736 / 49,377 / - [in contig]
Locationcomplement(49377..49736) [in whole cluster]
complement(49377..49736) [in contig]
TypeCDS
Length360 bp (119 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative transcriptional repressor
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[11182319] Novel features in a combined polyketide synthase/non-ribosomal peptide synthetase: the myxalamid biosynthetic gene cluster of the myxobacterium Stigmatella aurantiaca Sga15. (Chem Biol. , 2001)
Related Reference
ACC
P96631
PmId
[17511812] Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis. (Mol Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative transcriptional repressor]
MNEELASQIGSAARDARTHLGLTQAEVAEKLGIAHMVYSRLERGKMLPSVPTLLRMCAVL
HISADDLLGVSGEERGARLARGPRGEAEVPRVRQLLGLARKMDEEKLDALVTVAQVLLR
selected fasta
>putative transcriptional regulator [putative transcriptional repressor]
ATGAATGAAGAATTGGCGAGCCAAATTGGGAGTGCCGCCCGCGATGCCCGGACGCATCTG
GGGCTCACCCAGGCGGAAGTGGCCGAGAAGCTGGGGATCGCGCACATGGTCTACAGCCGC
CTGGAGCGGGGGAAGATGCTGCCCAGCGTCCCAACGCTTCTGCGTATGTGTGCCGTCCTG
CACATCTCCGCGGACGATCTGCTGGGAGTTTCGGGGGAGGAGCGGGGGGCCCGGTTGGCC
CGCGGTCCACGGGGGGAAGCGGAGGTGCCTCGGGTGCGCCAGCTCCTGGGGCTCGCGCGC
AAGATGGATGAAGAGAAGCTCGATGCGCTGGTGACCGTCGCTCAGGTCTTGTTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001387 Helix-turn-helix type 3 (Domain)
 [14-67]  9.40000000000003e-14 PF01381
PF01381   HTH_3
 [13-67]  PS50943
PS50943   HTH_CROC1
 [12-67]  6.40000038788486e-16 SM00530
SM00530   HTH_XRE
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [1-79]  1.20000117458134e-15 SSF47413
SSF47413   Lambda_like_DNA
 [9-116]  1.69999999999999e-18 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
SignalP No significant hit
TMHMM No significant hit
Myxa_00100 Myxa_00100   last last