close all open/close all
first first   Myxo_00020 Myxo_00020

CDS information : Myxo_00010


close this sectionLocation

Organism
StrainDW4/3-1
Entry nameMyxothiazol
Contig
Start / Stop / Direction1 / 834 / + [in whole cluster]
1 / 834 / + [in contig]
Location1..834 [in whole cluster]
1..834 [in contig]
TypeCDS
Length834 bp (277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productphosphopantetheinyl transferase
Product (GenBank)MtaA
Gene
Gene (GenBank)mtaA
EC number2.7.8.-
Keyword
Note
Note (GenBank)
  • Ppant transferase
Reference
ACC
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)
[11134965] The mtaA gene of the myxothiazol biosynthetic gene cluster from Stigmatella aurantiaca DW4/3-1 encodes a phosphopantetheinyl transferase that activates polyketide synthases and polypeptide synthetases. (J Biochem. , 2001)
Related Reference
ACC
P39135
PmId
[9484229] Characterization of Sfp, a Bacillus subtilis phosphopantetheinyl transferase for peptidyl carrier protein domains in peptide synthetases. (Biochemistry. , 1998)

close this sectionSequence

selected fasta
>phosphopantetheinyl transferase [MtaA]
MPTSSPALPLLKLPPDEVHVWIVEPERITEPGLLESYRALLDPGERDKQQRFYFERHRLQ
YLVSHALVRLTLSRYAPVAPEAWSFSANQYGRPEIRGEEKPWLRFNLSHTDGMALCAVAR
DVDVGADVEDTERRGETVEIADSFFAPAEVASLRALPVSGQRERFFDYWTLKEAYIKARG
MGLSLPLDQFAFEVSQGLSTRISFDPRLVDEPSQWQFVRFRPSQRHAAALAVRRPSEAPL
TVRFQRTVPLQDDAPAEYLSRERIQPLRLRMPGVGGG
selected fasta
>phosphopantetheinyl transferase [MtaA]
ATGCCGACGTCCTCCCCTGCGCTGCCCTTGTTGAAGTTGCCACCAGACGAAGTCCATGTC
TGGATCGTCGAGCCCGAGCGCATCACCGAGCCAGGGCTGCTGGAGTCCTACCGCGCCCTG
CTGGACCCAGGGGAGCGCGACAAACAGCAGCGGTTCTACTTCGAGAGGCACCGGCTGCAG
TACCTCGTCTCTCATGCGCTCGTGCGGCTCACCTTGTCGCGCTATGCGCCCGTGGCGCCC
GAGGCCTGGTCCTTCTCCGCCAACCAGTACGGCCGGCCGGAGATCCGGGGTGAGGAGAAA
CCGTGGTTGCGTTTCAACCTCTCCCACACGGATGGGATGGCCCTCTGCGCGGTGGCCCGC
GATGTGGATGTGGGAGCCGATGTGGAGGACACCGAGCGGAGAGGGGAAACGGTGGAGATC
GCCGACAGCTTTTTCGCCCCCGCCGAGGTGGCCTCGCTTCGGGCACTCCCGGTGAGTGGC
CAGCGCGAGCGCTTCTTTGATTATTGGACCTTGAAGGAGGCCTACATCAAGGCGCGTGGA
ATGGGGCTTTCCCTGCCCTTGGACCAGTTCGCCTTCGAGGTTTCGCAGGGGCTTTCCACC
CGGATTTCCTTTGATCCGCGTCTGGTGGACGAGCCCTCTCAGTGGCAGTTCGTACGGTTC
CGGCCCTCCCAGCGGCACGCCGCCGCGCTGGCTGTGCGCCGCCCCTCGGAGGCCCCCCTC
ACGGTGCGGTTTCAGCGCACCGTTCCGCTCCAGGATGATGCACCTGCGGAGTATCTCTCA
CGAGAGCGGATCCAGCCGCTGCGCCTCCGGATGCCCGGGGTGGGAGGAGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [124-230]  1.4e-16 PF01648
PF01648   ACPS
 [18-128]  1.4e-31 SSF56214 [122-246]  4.3e-27 SSF56214
SSF56214   4'-phosphopantetheinyl transferase
 [123-232]  5.3e-12 G3DSA:3.90.470.20
G3DSA:3.90.470.20   no description
SignalP No significant hit
TMHMM No significant hit
first first   Myxo_00020 Myxo_00020