close all open/close all

CDS information : Myxo_00020


close this sectionLocation

Organism
StrainDW4/3-1
Entry nameMyxothiazol
Contig
Start / Stop / Direction1,388 / 13,399 / + [in whole cluster]
1,388 / 13,399 / + [in contig]
Location1388..13399 [in whole cluster]
1388..13399 [in contig]
TypeCDS
Length12,012 bp (4,003 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)MtaB
Gene
Gene (GenBank)mtaB
EC number
Keyword
Note
Note (GenBank)
  • PKS; MtaB loading domain and module 1: polyketide synthase domains: ACP, KS, AT, AT, DH, ER, KR, ACP; MtaB module 2: polyketide synthase domains: KS, AT, DH, KR, ACP
Reference
ACC
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)

close this sectionPKS/NRPS Module

0
1 malonyl-CoA
not conserved HAFHS(H->Y)
2 methylmalonyl-CoA
ACP17..86
KS108..482
AT558..872
AT986..1302
DH1344..1510
er
KR1850..2029
ACP2121..2191
KS2220..2597
AT2757..3073
DH3117..3282
KR3633..3812
ACP3912..3981

close this sectionSequence

selected fasta
>polyketide synthase [MtaB]
MSTEHGVGGVGRSTGQLRDWLVQQVASQVGLEAHTVRITEPFFSLGVGSVFATRLIAELA
RWLERPLSPTLVWEHPTIDKFARHLSGAEPPRAEMHAPGPEAAVDGAEPIAIVGLACRFP
KAPDAKAFWRVLQEGRDCVTEVPSNRWDASLYYDPAPGTPGKIVTRYGAFLDSVDRFDPV
FFGISPREAGQLDPQQRLMLELSWEALEDAGIAPRVLRGSRTGVFTGMVWRDYADLQTIH
NAAPTLHTCTGYAGGIIANRISYALGLEGPSLAIDTACSSSLVAIHEACRSLRSGESSLA
LAGGVQLNLSPRTFMAVSAFGALAPDGRCRTFDARASGYVRGEGGGVLVLKPLSRALADG
DAIYCLIRGSAVNNDGASNGLTAPNPKAQERLLRDAYAVAGMDPAQVHYVELHGTGTPLG
DPIEAGALGAVLGAAREAERPLHVGSVKTNIGHLEAAAGIASVIKVALSIRHQQLPASLH
FEQPNPRIPFDDLRLRVQTQLAPWPAEKDPAVAGISAFGFGGTNCHVVVEEHRGGSRTAA
VPVSTPHAQSPRHPKTAFLFAGAGSAWWGMGRELLGAEPVFRARFEECDAAFRPLGGWSL
VEALLAPRVRSRFEQGERQLPLVLAFQISLAALWRSWGIEPSATVGYSVGEWAAAQVAGI
LTIEEVFALAYHYIQVQKGVAGGVGMAVVGLSGAEVAERIAPYGGRISIASENGPRSTGL
GGEAAALQDFTASMTAAGIFARLVEIDFYAHIPQVEALKPLFLQSCPVLRPSPGRVPMVS
TVSGAFVDGGTLGAEYWASNFREPVRFATAMRTLLEGGYDVVLDVNPHPIHEHSVLENVR
AGTASAEFIASMRRGEPSVEGLHRALTQLSQAGGPVRWERVVPGTGAGSSAPVRTELFVA
SARTEQALREQADRIAEQLRRDAASSLTDLCYTAGARRSHHEHRLALVAETRAALEEGLA
AFARGEIRPNPSQGMVRPGEAPRLGFVFSGQGSFPLGSSVQLFEEEPSFRKAFERSERLF
RAQTGASLIEALHAERESQHPPRTEIEQPLLFAFQVALAALWESWGIRPDAVVGHSVGEI
SAAHVAGVLSLEEALSLVVSRSRLMGRAAGQGGMATVEASPARIEPLLGKCGTDLAIAAV
NGPENVVVSGALAALASLRDELTGQGLRVRVLNVNYAFHSAQMAPYLGDLDPVLRELKPK
PPRLPIYSTVHGRLASASDFGTDHWRANVRERVLFAPAVEAMRADGHGAFVEISPHPVLL
QPLSRILDASPASGASALFSTRRDRAPRAALLGNLGTLYTLGHEPSWKGVFPDLGRTVEL
PSYPWQRQRCWFDAAPQPLAEPVHPLLGRRVDAPPGQTVFEATFRSDRLQLLSDHRLYGT
VVVAGASMLGMMLVAARQLWGEAPCALQDVLFLQPLVLGDTEDRLVQVSIATDGAFRILS
WAGQGGEGTSSHWIEHATGRLERGGAEETEAGREVLSEVEARCRPLASAESFYEGIARQG
LGLGRQFRWLEALWQGDREAFGRLRVPETDDGAEDYRFHPGLIDSCFQVLGAVAGFASIE
GLAFVPIGVGRFALRGEARPPRFCHLVLRRGSGKANEASSVDLRLLDESGLVVAEVSGLV
IRRAPREVMLRRDVTAPPLVLRTEWQPQMLSGASQAGPEAWLLLADRGGLAARLAEQLSS
RGSRVEVLAAEENAQSMLGRIEAIDASGLACAGVVDLRGLDEGSSSDAVQGAVKRVQQLV
TRRAAEALRLVLVTRGTQVTGSQDGSIAFEQAPLWGLGNVIALEHPELRCQRIDLDPSPG
APDAAQLAAELAAPGREDRVAFREGRRLVARLVRTKLPPAVRALPLEGDATYLIVGGLGG
IGLELARWMVGRGARHLVLMGRSAPSAHAQETLAALRDAGATISVALGNVAEREALARVL
GDIRAAMPPLRGVMHAAGVLDDGLLVRQSEERLARVLAPKIQGAMNLHRETVGDRLDFFV
LFSSVSSVFGTSGQAGYASANAFLDALALHRRAQGLTALSINWGPWADVGMAARLPPEAG
KSWSSFGLGLLAPSAGLAALERLLSSEAAQVVVAGASEAEAKGDFAPFFDALSSRKPEAS
RPASVGGALVGASPRELRARLLSLLQVQAATVLGLPPSAPIDPRRPLQELGLDSLMALQF
RNSLAASLGRSLPATLLFDHPTLEKLFEFLARDLTPASEASPAKSRRPVKLPARDAEGAE
PIAVVGMACRLPGSVRSPEEFWRLLANGVNAVREVPKDRWSLDTWYDPDPETPGKMYSRH
GGFLDEVDPFDASFFGISAPEARSMDPQQRILLELGWEALESAGIAVDQLKGSPTGVFLG
ICLSDYALLELNSPDPTGINAYSGSGGVLSVAAGRIAYALGLEGPTLAVDTACSSSLVAA
HLACQSLRNGECDLALVGGSNLLLSPRMSVYFSKLKALSPDGACKAFDSSANGYVRGEGA
GVLVLKRLSEALADGDPILSVMRGTAVNQDGRSNGLTAPSRAAQERVIESALRQGGVSPL
DVSYVEAHGTGTSLGDPIEVQALAAVLGKDRPRSAPLGIGSVKTNVGHLEGAAGVTSLIK
AILALRHRELPRSLHFKTPSPHIPWDELPVEVISEHRPWRVPEGKRRILGVSSFGFSGTN
AHVILEEAPEAGPRSKAPSIPERPELLVLSARAPQALQEAAVRFSAQLSGRAGGDAAMLH
DVCYSANCRRSHHEHRLAVVARSRTEAAEALEAFLRGLAHPDVQAGYALPGAVPRVVFLF
TGQGGQWPGTGRALLEEEPVFRSALQAADEVLKGLAGWSIIEELQRETPRFDQAAISQPA
HFALQSALLALLRSWGIEPDAVAGSSIGEVAAAYAAGVLTLEEAMRITVARSRILHAVAG
KGAMALVELSEEEATTEVAAYAQRLSVAAINSQNSTLLSGEAGAMDELLGALTARGVSCR
RIGLDYASHSPAVEPYIDELKQALQGLRPQPAAIPIFSTVTGRLAEAGDFNSDYWARNLR
QPVRLAPVLTTLAREDYTLFVELGPNAVMARPVQQCFQAVGKSATLLSTLRRGESERHTL
RSLVGGLFIAGVTPAWNRLFPEGGSLVSLPSYPWQKERYWIASPTSARLQLPAPSQGVLH
GRRVRSPLAESLFETDLSVEKMPFLREHLLHGALVVAGAAHVALALSALRELRGTAPVRL
ADIVFPRPLVLKEGVENPVSVVVGREQGGRSALRIQSPQGSEPEWVTHAEGWVLPASSQV
EGPAQVALEELRARCPNGLEVSPVYKAMDAEGIGLGRRFQWVEQLWQGDGEALGRMRAAE
SADQHPSAPLHPGLIDSIFHVLRAVPGIGRGDGVPYIPIGIEGLCFLAPPRGVLWAHVKL
RPEGSRDGETLSADFRLFEESGKTVAWIDGLIVKRAPREAFQRHEAQDLSEKLFQVRWQS
MPLAPAVPERGPWLLVADRGPAGEELAARLKREGQVCHVLAAPESAVTGEALLQRVEEAL
ALEAYRGVVYLSALEAEQESPQGKSQAALEGVSGAVQVLQAIAKLERGTPPRLWLVTRGA
QALEESPRPLALAQAPLWGLGLAVRDEHPELRCTLIDLDPDPAADGVGCLFQELLTPDRE
DRIAWRGGARFAQRLSFLEAVPEPGTAPISPDGTYLITGGLGGIGLRCARWLVDAGARHL
ALLGRSGPSEAARSVLGALEAEGVTVRVLQADVAVREDVSKVLSALRVDMPPLRGVLHAA
GLLDDALLVRQDRDRIQRVLQPKVAGALNLDLETRGDPLDFFVLFSSIAAMLGGEGQGNY
SAANAFLDALAFARRAQGLPAHSLAWGPWAEVGMVAARSERSAHLAALGIESIPPDEGVA
ILGRLLRAASAHVGIFQIDWTRWQQRHAEGHAPLLAGILKQQAAAPSQDSSEEAPDIQEL
IRATPEERQKRAEAFLRREVTRILDLPRPLADGRLPLVRFGFDSLMSLKLKARLESTLGL
SISAAKLLSGLSLDKLVALVLERIETLQPTPVSTDDQMEDFRF
selected fasta
>polyketide synthase [MtaB]
ATGTCGACAGAACATGGTGTTGGGGGAGTTGGCCGGAGCACCGGCCAACTTCGTGATTGG
CTCGTACAGCAGGTGGCCTCACAGGTTGGACTTGAGGCGCATACTGTAAGGATTACCGAG
CCCTTCTTCAGTCTGGGGGTGGGCTCTGTCTTCGCCACGAGGCTGATCGCCGAGCTCGCC
CGGTGGCTTGAGCGGCCTCTGTCCCCCACGCTGGTTTGGGAGCACCCGACCATCGACAAG
TTCGCCCGCCACCTTTCAGGGGCCGAGCCACCCCGGGCGGAAATGCATGCGCCAGGCCCC
GAAGCCGCCGTGGATGGGGCTGAGCCGATCGCAATCGTGGGTCTGGCTTGTCGCTTTCCC
AAGGCCCCCGATGCGAAGGCTTTCTGGAGAGTGCTCCAGGAAGGTCGCGATTGTGTCACA
GAGGTTCCAAGCAACCGCTGGGATGCCAGTCTCTATTATGATCCGGCACCCGGAACGCCG
GGGAAGATCGTCACGCGCTACGGCGCGTTCCTCGATTCTGTCGATCGCTTTGACCCGGTC
TTCTTCGGCATCTCCCCCCGTGAGGCCGGGCAGCTGGATCCGCAGCAGCGTTTGATGCTG
GAGCTGTCCTGGGAGGCGCTGGAGGATGCTGGCATCGCTCCACGCGTGCTTCGCGGCTCC
CGGACCGGTGTCTTCACTGGCATGGTCTGGCGCGATTACGCCGACCTGCAGACGATCCAC
AATGCGGCGCCGACGCTTCATACCTGCACCGGTTACGCGGGTGGCATCATCGCCAACCGG
ATCTCGTATGCGCTCGGCCTTGAGGGGCCGAGCCTGGCGATCGACACGGCGTGCTCCTCT
TCGCTCGTGGCCATCCACGAGGCGTGCCGCAGCTTGCGCTCTGGAGAGTCGTCCCTCGCC
CTGGCGGGAGGGGTTCAGCTCAACCTCTCACCTCGCACCTTCATGGCGGTCTCGGCCTTC
GGCGCCCTTGCTCCCGATGGACGGTGCAGGACGTTCGATGCGCGGGCGAGTGGTTACGTG
CGGGGAGAAGGCGGGGGCGTGCTGGTGCTCAAGCCGCTCTCCCGTGCCCTGGCGGATGGC
GATGCCATCTACTGCCTGATTCGCGGCAGCGCGGTGAACAACGACGGGGCGAGCAACGGC
CTGACTGCCCCCAACCCCAAGGCTCAGGAGCGGCTGCTGCGGGATGCCTATGCCGTCGCG
GGCATGGATCCAGCCCAGGTTCACTACGTCGAGCTGCATGGGACGGGAACGCCGCTCGGC
GATCCAATAGAGGCAGGGGCACTGGGCGCGGTCCTGGGGGCGGCGCGGGAAGCGGAACGC
CCGCTCCATGTTGGCTCGGTGAAGACCAACATTGGACATCTCGAAGCCGCGGCGGGGATT
GCCAGCGTCATCAAGGTGGCGCTGTCGATCCGGCACCAGCAGCTTCCCGCGAGCCTGCAT
TTCGAGCAGCCGAATCCTCGGATTCCGTTCGACGATCTCCGGCTGCGCGTCCAGACCCAG
CTTGCCCCCTGGCCAGCGGAGAAAGACCCTGCTGTTGCCGGCATCAGCGCCTTCGGCTTC
GGTGGTACGAACTGCCACGTCGTCGTGGAAGAGCACCGCGGCGGGTCGCGCACGGCTGCC
GTGCCGGTGAGCACTCCCCACGCCCAATCGCCACGGCACCCGAAGACCGCTTTTCTCTTC
GCGGGCGCTGGCTCGGCCTGGTGGGGCATGGGGCGAGAGCTCCTGGGGGCGGAACCAGTT
TTCCGTGCCCGCTTCGAGGAGTGTGATGCGGCGTTCCGGCCCCTCGGGGGCTGGTCCCTG
GTCGAGGCCCTCCTGGCCCCGCGGGTGCGCTCGCGCTTCGAGCAAGGGGAGAGACAGCTG
CCCCTGGTCCTCGCGTTCCAGATCTCCCTCGCGGCCTTGTGGCGTTCCTGGGGCATCGAG
CCCAGCGCGACCGTGGGCTACAGCGTCGGCGAATGGGCCGCGGCGCAGGTGGCTGGGATC
CTCACCATCGAGGAGGTTTTCGCGCTCGCTTACCACTACATCCAGGTGCAGAAGGGCGTC
GCCGGCGGTGTGGGGATGGCCGTGGTGGGTTTGTCTGGCGCCGAGGTGGCGGAGCGCATC
GCGCCCTATGGGGGACGGATCTCCATTGCCTCCGAGAATGGTCCTCGCTCGACGGGCCTG
GGAGGAGAGGCGGCGGCACTTCAGGACTTCACCGCGAGCATGACCGCGGCGGGAATCTTC
GCGCGCCTCGTGGAGATCGATTTCTACGCGCACATTCCTCAGGTCGAGGCGCTCAAGCCG
CTCTTTCTCCAGAGCTGCCCGGTGTTGCGTCCGTCGCCGGGCCGTGTCCCCATGGTGTCG
ACGGTCTCCGGCGCCTTCGTTGACGGCGGGACGTTGGGGGCGGAGTACTGGGCGAGCAAC
TTCCGCGAGCCCGTGCGCTTCGCCACCGCCATGAGGACCCTGCTGGAGGGTGGCTACGAT
GTCGTCCTGGACGTCAATCCCCACCCGATCCACGAGCACTCGGTTCTGGAGAATGTCCGG
GCAGGGACGGCGAGTGCCGAGTTCATCGCCAGCATGCGTCGCGGAGAGCCTTCCGTGGAG
GGGCTTCACCGGGCGCTGACGCAGCTCTCCCAAGCCGGTGGCCCGGTCCGTTGGGAGCGC
GTGGTTCCAGGCACGGGCGCTGGATCGTCCGCTCCGGTCAGGACCGAGCTGTTCGTCGCC
TCGGCCAGAACGGAGCAGGCGCTTCGTGAGCAGGCGGACCGCATCGCTGAACAGCTTCGC
CGCGATGCTGCCTCCTCGCTCACGGACCTCTGTTACACGGCGGGTGCCCGCCGCAGCCAT
CACGAGCACCGGCTCGCCTTGGTCGCGGAGACGCGCGCCGCGCTGGAGGAAGGTCTGGCG
GCGTTCGCCCGTGGCGAGATCCGGCCAAACCCATCGCAGGGGATGGTCCGCCCTGGAGAA
GCCCCTCGACTCGGCTTCGTGTTCTCGGGGCAAGGCTCCTTCCCGCTTGGCTCGAGCGTC
CAGCTCTTCGAAGAAGAGCCTTCCTTCCGGAAAGCTTTCGAACGGAGTGAGCGGCTGTTC
CGTGCGCAAACGGGTGCCTCCCTCATCGAGGCACTCCATGCCGAGCGCGAGAGCCAGCAC
CCGCCTCGGACGGAGATTGAACAGCCCCTCCTGTTTGCTTTTCAGGTCGCGCTTGCCGCG
CTCTGGGAGTCCTGGGGCATCCGTCCCGATGCCGTGGTGGGCCATAGTGTCGGTGAGATC
AGCGCCGCCCACGTGGCCGGGGTCCTCTCCTTGGAGGAGGCGCTCTCCTTGGTCGTGAGC
CGCAGCCGCCTCATGGGCCGCGCGGCCGGGCAGGGAGGCATGGCGACGGTCGAGGCATCT
CCTGCCCGGATCGAGCCCCTTCTGGGCAAGTGCGGGACCGATCTCGCGATCGCGGCCGTC
AATGGACCCGAGAACGTGGTCGTCTCGGGAGCACTCGCCGCCCTGGCATCCTTGCGGGAC
GAGCTCACGGGCCAAGGCCTGCGCGTTCGTGTCTTGAACGTCAACTACGCCTTTCACAGT
GCGCAGATGGCCCCCTACCTGGGGGACCTCGACCCCGTTCTGCGTGAGCTCAAGCCGAAG
CCTCCGCGGCTGCCCATCTATTCGACTGTGCACGGCCGCTTGGCTTCTGCGTCGGACTTT
GGCACGGACCACTGGCGCGCCAATGTCCGGGAGCGTGTCCTTTTCGCGCCCGCCGTCGAG
GCGATGCGGGCCGATGGTCATGGCGCCTTCGTCGAGATTTCCCCGCATCCTGTTCTCTTG
CAGCCTTTGAGCCGCATCCTCGATGCGTCGCCAGCCAGCGGTGCGTCAGCGCTGTTCTCG
ACGCGCCGGGACCGGGCCCCCCGGGCCGCGCTGCTCGGCAACCTGGGGACACTCTACACG
TTGGGTCATGAGCCTTCGTGGAAGGGGGTCTTCCCCGATTTGGGACGGACGGTGGAACTC
CCGTCCTATCCCTGGCAGCGGCAGCGCTGTTGGTTCGATGCAGCTCCTCAGCCGCTTGCT
GAGCCAGTCCACCCCCTTTTGGGGCGCCGGGTGGATGCCCCCCCTGGCCAAACCGTCTTC
GAGGCCACCTTCCGCAGTGATCGCCTTCAGCTGCTCAGCGACCACCGGCTCTACGGCACG
GTGGTGGTCGCGGGCGCCAGCATGCTCGGCATGATGCTCGTGGCCGCCAGGCAACTCTGG
GGCGAAGCGCCCTGTGCGCTGCAAGATGTTCTGTTCCTCCAGCCTCTCGTGCTTGGCGAC
ACGGAGGACCGGCTCGTTCAGGTGTCGATCGCGACGGACGGTGCTTTCCGGATCTTGAGC
TGGGCAGGGCAGGGCGGTGAAGGAACTTCTTCACATTGGATCGAGCACGCCACGGGGCGG
CTCGAGCGTGGCGGTGCGGAAGAGACCGAAGCTGGGCGCGAAGTGCTGTCCGAGGTGGAG
GCACGTTGTCGGCCGCTCGCGTCCGCCGAGAGCTTCTATGAGGGCATCGCCCGGCAGGGT
TTGGGTCTGGGCCGGCAGTTCCGGTGGCTCGAAGCGCTGTGGCAAGGGGACCGCGAGGCT
TTTGGCCGGTTGCGTGTTCCAGAGACGGACGACGGGGCCGAGGACTACCGGTTTCATCCA
GGGCTCATCGATTCGTGCTTCCAGGTTCTGGGGGCTGTCGCGGGGTTCGCATCCATCGAG
GGTCTTGCCTTCGTGCCCATTGGGGTGGGCCGCTTCGCGCTTCGCGGGGAGGCCCGCCCG
CCGCGCTTCTGCCATCTGGTGCTCCGCAGGGGGTCAGGCAAGGCCAACGAGGCATCGAGC
GTGGACTTGCGCTTGCTCGATGAGTCGGGACTGGTTGTGGCAGAGGTCTCCGGGCTGGTG
ATTCGCCGGGCACCACGGGAAGTCATGTTGCGCCGTGACGTCACCGCGCCGCCGCTCGTG
CTCCGGACGGAATGGCAGCCACAGATGTTGTCCGGAGCCTCCCAGGCAGGGCCCGAGGCT
TGGTTGCTCCTGGCGGATCGTGGCGGTCTGGCCGCACGGCTTGCTGAACAGCTCTCGTCC
CGAGGCAGCCGCGTGGAGGTGCTCGCCGCCGAGGAGAACGCACAGTCGATGCTTGGACGC
ATCGAAGCCATCGATGCGTCGGGTTTGGCCTGCGCGGGGGTCGTCGATCTGCGGGGCCTC
GATGAGGGCTCTTCGAGCGATGCGGTTCAAGGGGCCGTCAAGCGGGTGCAGCAGTTGGTC
ACTCGCCGTGCCGCGGAGGCGCTCCGCCTTGTCCTGGTGACGCGTGGAACACAGGTGACT
GGAAGCCAGGACGGGTCCATCGCCTTCGAGCAAGCGCCACTTTGGGGGCTCGGCAATGTC
ATCGCGCTGGAGCACCCCGAACTGCGCTGCCAGCGGATCGACCTGGATCCATCCCCTGGT
GCACCGGACGCTGCCCAGCTTGCCGCGGAGCTCGCGGCGCCAGGGCGAGAGGATCGCGTG
GCCTTCCGGGAGGGCCGGCGCCTCGTTGCCAGGCTCGTGCGCACCAAGCTTCCCCCCGCC
GTGCGTGCCCTTCCACTGGAGGGTGACGCGACGTACCTGATCGTGGGTGGGCTCGGTGGC
ATTGGCCTCGAGCTGGCCCGGTGGATGGTGGGGCGAGGGGCTCGTCACCTGGTCCTGATG
GGCCGAAGTGCGCCGAGCGCACATGCCCAGGAGACCCTGGCTGCGCTGAGGGATGCAGGC
GCCACCATCTCCGTGGCTTTGGGCAACGTGGCCGAGCGTGAGGCGCTCGCGCGGGTGCTC
GGTGACATTCGCGCCGCCATGCCTCCGCTTCGCGGTGTCATGCATGCGGCGGGTGTCCTC
GACGATGGGTTGCTGGTCCGCCAGAGCGAGGAGCGGCTCGCCCGTGTTCTCGCGCCGAAG
ATCCAGGGCGCGATGAACCTTCACCGTGAGACGGTGGGGGACCGCCTCGACTTCTTTGTC
CTCTTCTCGTCGGTCAGCTCGGTGTTTGGGACCTCGGGACAGGCAGGGTACGCCTCCGCC
AATGCCTTCCTGGATGCGTTGGCGCTTCACCGGCGCGCCCAAGGCCTGACGGCGCTGTCC
ATCAACTGGGGCCCCTGGGCGGACGTGGGCATGGCGGCACGCCTTCCGCCCGAAGCGGGC
AAGTCTTGGTCTTCCTTTGGATTGGGTCTTCTCGCTCCCAGCGCGGGCCTCGCGGCGCTG
GAGCGGCTTCTGAGCTCCGAAGCTGCCCAGGTGGTGGTGGCTGGTGCCTCAGAGGCCGAG
GCAAAAGGAGACTTCGCTCCTTTCTTTGACGCGTTGTCTTCCAGAAAGCCCGAGGCGTCC
CGCCCTGCTTCCGTGGGGGGAGCCCTCGTGGGGGCTTCGCCCCGCGAGCTTCGCGCCCGG
CTGCTCTCGCTCTTGCAGGTGCAGGCGGCCACGGTGCTCGGCTTGCCTCCATCGGCTCCG
ATCGATCCCCGCCGTCCGTTGCAGGAGTTGGGGCTCGACTCGCTCATGGCACTGCAGTTC
CGCAACAGCCTTGCGGCGAGCCTTGGGCGCTCTCTTCCCGCCACGCTGCTCTTCGATCAT
CCGACGCTCGAGAAGCTCTTCGAGTTTCTTGCGCGAGATCTCACCCCCGCGAGCGAGGCA
TCCCCTGCGAAGTCCCGGCGGCCCGTCAAGCTGCCCGCGAGGGACGCGGAAGGGGCCGAG
CCCATTGCGGTGGTGGGAATGGCGTGCCGGCTGCCCGGCAGTGTCCGAAGTCCCGAGGAG
TTCTGGCGGCTTCTCGCCAATGGCGTGAACGCGGTGCGAGAGGTTCCCAAGGATCGTTGG
AGCCTCGACACCTGGTACGACCCTGATCCTGAGACGCCGGGCAAGATGTACTCCCGGCAT
GGAGGGTTTCTCGACGAGGTCGATCCTTTCGACGCCTCGTTCTTCGGGATCTCCGCGCCA
GAGGCCCGGTCCATGGACCCGCAGCAGCGGATCCTGCTCGAGCTTGGCTGGGAGGCCCTG
GAGAGCGCGGGCATCGCGGTGGATCAGCTCAAGGGCAGTCCTACCGGCGTGTTCCTCGGC
ATCTGCCTGAGCGACTACGCCCTGCTCGAGCTGAATTCTCCTGATCCAACGGGCATCAAC
GCCTACTCGGGATCGGGAGGCGTGCTGAGTGTGGCCGCGGGGCGCATCGCCTATGCACTC
GGTCTGGAGGGACCGACGCTCGCCGTTGATACGGCCTGCTCGTCCTCGCTGGTGGCTGCG
CACCTCGCGTGCCAAAGCCTGCGCAATGGCGAATGCGATCTGGCCTTGGTCGGTGGATCG
AACCTGCTGCTCTCGCCCCGGATGTCGGTCTACTTCTCGAAGCTGAAGGCCTTGTCACCG
GATGGTGCCTGCAAGGCTTTTGACAGCTCCGCCAACGGGTACGTGCGCGGTGAGGGGGCG
GGCGTCCTGGTCCTGAAGCGCTTGTCGGAGGCTCTCGCGGATGGGGATCCGATCCTCTCC
GTGATGCGTGGGACGGCCGTCAATCAGGATGGCCGTTCGAATGGTCTCACGGCCCCAAGC
CGGGCAGCTCAGGAGCGGGTGATCGAGAGTGCGCTCCGGCAGGGAGGCGTCTCGCCTCTC
GATGTCAGCTACGTCGAGGCCCACGGAACGGGGACTTCGCTGGGGGATCCGATCGAAGTG
CAGGCGCTCGCCGCCGTCCTCGGAAAGGACCGCCCACGCTCGGCGCCGTTGGGAATTGGC
TCGGTCAAGACCAACGTCGGGCACCTGGAGGGTGCCGCGGGGGTCACCAGCCTGATCAAG
GCGATCCTCGCACTGCGGCACCGGGAGCTGCCCCGGAGCCTCCACTTCAAGACGCCGAGC
CCACATATTCCGTGGGATGAGCTGCCGGTCGAGGTGATCTCCGAGCACCGGCCCTGGCGT
GTGCCAGAAGGGAAGCGCCGGATCCTCGGCGTCAGTTCCTTTGGATTCAGTGGGACCAAT
GCCCATGTCATCCTGGAGGAGGCTCCCGAGGCAGGGCCTCGCTCAAAGGCTCCGAGCATC
CCTGAGCGTCCCGAACTGCTCGTGCTCTCCGCCCGTGCGCCTCAGGCGCTCCAGGAGGCG
GCTGTGCGCTTCTCCGCCCAGTTGTCGGGCCGGGCCGGGGGGGATGCCGCGATGCTGCAC
GACGTCTGTTACTCGGCGAACTGTAGACGGAGCCACCATGAGCATCGTCTCGCCGTGGTG
GCTCGATCCCGTACCGAAGCAGCAGAGGCCCTGGAGGCCTTCCTTCGCGGCCTGGCCCAT
CCCGATGTGCAAGCGGGATACGCCCTTCCAGGCGCGGTGCCTCGGGTGGTTTTCTTGTTC
ACGGGGCAGGGAGGGCAGTGGCCGGGAACAGGCCGCGCCCTTCTCGAAGAAGAGCCCGTC
TTCCGGAGCGCACTCCAGGCGGCGGATGAAGTGCTCAAGGGGCTCGCGGGCTGGTCGATC
ATCGAGGAACTCCAGCGGGAAACCCCTCGGTTCGATCAAGCGGCCATCTCTCAGCCTGCG
CACTTTGCCCTCCAATCCGCGCTCCTGGCGCTGTTGCGCTCCTGGGGAATCGAGCCCGAT
GCGGTCGCGGGCTCCAGCATCGGGGAAGTCGCGGCTGCCTATGCCGCCGGGGTCCTGACG
CTCGAGGAGGCAATGCGGATCACCGTGGCGCGGAGCCGCATCCTCCATGCGGTCGCGGGC
AAGGGGGCCATGGCCCTCGTCGAGCTCTCCGAAGAAGAGGCCACCACGGAGGTAGCGGCT
TACGCGCAACGGTTGTCGGTCGCGGCGATCAACAGCCAGAACTCCACGCTGCTGTCGGGT
GAAGCCGGGGCGATGGACGAACTCCTCGGGGCACTCACCGCCCGGGGGGTTTCTTGCCGC
CGGATTGGCCTCGACTATGCGTCGCACAGCCCCGCTGTCGAGCCCTACATCGATGAGCTG
AAACAGGCCCTTCAGGGGCTTCGCCCCCAGCCTGCGGCAATCCCCATCTTCTCCACGGTC
ACGGGCCGTCTCGCGGAGGCGGGGGATTTCAACAGTGACTACTGGGCACGAAACCTCCGC
CAGCCGGTTCGCCTCGCGCCTGTGCTCACCACTCTCGCGCGTGAGGACTACACGCTCTTC
GTGGAACTCGGGCCCAACGCCGTCATGGCCCGTCCTGTTCAGCAGTGTTTCCAGGCGGTC
GGCAAGAGCGCGACGTTGCTGTCGACGTTGCGGAGGGGAGAGTCCGAGCGGCATACCCTC
CGGAGCCTCGTGGGTGGACTCTTCATCGCCGGGGTGACTCCGGCGTGGAACCGTTTGTTT
CCGGAGGGAGGGTCGCTGGTTTCCCTGCCTTCCTATCCTTGGCAGAAGGAGCGGTACTGG
ATCGCGAGCCCCACGTCGGCTCGCCTGCAACTTCCGGCGCCGAGCCAAGGTGTCCTTCAT
GGGCGCCGCGTGCGGTCCCCACTGGCGGAGAGCCTGTTCGAGACGGATCTGTCCGTCGAA
AAGATGCCTTTCCTGCGCGAGCACCTGCTTCATGGCGCGCTGGTGGTCGCGGGAGCGGCA
CATGTGGCCCTGGCGCTCTCGGCGCTCCGGGAATTGCGTGGCACCGCTCCGGTGCGCCTT
GCCGACATCGTCTTTCCGCGCCCGTTGGTTCTGAAGGAGGGCGTGGAAAACCCCGTCTCG
GTGGTGGTGGGGCGGGAGCAGGGAGGCCGCTCCGCGCTTCGCATCCAAAGTCCGCAGGGC
TCGGAGCCGGAGTGGGTGACGCATGCCGAGGGGTGGGTTCTGCCCGCCTCGTCACAGGTC
GAGGGGCCCGCACAGGTGGCCCTGGAGGAACTGCGTGCCCGCTGCCCCAACGGACTGGAG
GTGTCTCCGGTCTACAAGGCCATGGACGCCGAAGGGATCGGGCTGGGCCGCCGCTTCCAG
TGGGTCGAGCAGCTCTGGCAGGGCGATGGGGAGGCGCTGGGACGGATGCGGGCTGCCGAG
TCCGCGGATCAGCATCCAAGTGCTCCGCTTCACCCTGGCCTGATCGACTCCATCTTCCAC
GTCCTGCGCGCGGTTCCTGGAATCGGCCGGGGCGATGGCGTCCCTTACATTCCCATCGGG
ATTGAAGGGTTGTGCTTCCTGGCACCGCCTCGCGGTGTGCTGTGGGCGCACGTGAAGTTG
AGGCCCGAAGGCAGCCGCGATGGGGAGACGCTGAGCGCGGATTTCCGTCTCTTCGAGGAG
AGCGGCAAGACGGTCGCGTGGATTGATGGATTGATCGTCAAGCGTGCACCACGCGAAGCC
TTCCAGCGTCATGAGGCGCAAGACCTGAGCGAGAAGTTGTTCCAGGTTCGCTGGCAGTCC
ATGCCTCTGGCCCCGGCTGTGCCCGAGCGCGGCCCGTGGTTGCTTGTGGCCGATCGAGGT
CCCGCGGGAGAGGAACTGGCCGCGCGGCTCAAGCGCGAAGGACAGGTGTGCCATGTGCTC
GCCGCGCCCGAGTCGGCTGTGACGGGTGAAGCGCTTCTCCAGAGGGTGGAAGAGGCCCTC
GCCTTGGAAGCCTACCGAGGCGTGGTCTACCTCTCGGCGCTCGAGGCAGAGCAGGAGTCT
CCGCAGGGCAAGTCCCAGGCGGCCCTGGAGGGCGTGTCCGGCGCGGTCCAAGTTCTTCAG
GCCATTGCGAAGCTGGAGCGCGGAACACCGCCCCGCCTCTGGTTGGTCACCCGGGGTGCG
CAGGCGCTGGAAGAGAGCCCCCGGCCCTTGGCGCTCGCCCAGGCGCCTCTCTGGGGGCTG
GGCCTCGCGGTGCGCGATGAGCATCCCGAACTTCGGTGCACCCTCATTGATCTGGACCCC
GATCCGGCGGCGGATGGAGTGGGATGCCTGTTCCAGGAGCTTCTGACCCCTGATCGTGAA
GACCGGATCGCCTGGCGCGGTGGCGCTCGGTTCGCACAGCGGCTTTCGTTCCTCGAAGCG
GTGCCAGAGCCTGGCACGGCGCCCATTTCGCCTGATGGCACCTACCTGATCACGGGAGGT
CTCGGAGGGATCGGCTTGCGCTGTGCTCGATGGCTCGTGGACGCGGGGGCCCGGCATCTG
GCGTTGCTTGGCCGCAGTGGGCCCTCCGAAGCAGCTCGATCGGTGCTGGGGGCACTGGAA
GCCGAAGGCGTCACGGTGCGGGTGCTTCAGGCAGACGTCGCTGTTCGCGAGGATGTCTCG
AAGGTGCTGTCGGCACTCCGCGTGGACATGCCTCCCCTCCGGGGCGTTCTCCATGCCGCG
GGCCTGCTCGACGATGCATTGCTCGTCCGCCAGGATCGTGACCGCATCCAACGCGTCCTC
CAACCGAAGGTCGCGGGTGCACTGAACCTGGATCTGGAGACGCGCGGCGATCCGCTCGAC
TTCTTCGTGCTGTTCTCTTCGATCGCCGCGATGCTCGGGGGCGAAGGGCAGGGCAATTAC
AGCGCCGCGAATGCCTTCCTGGACGCATTGGCCTTCGCTCGGCGCGCCCAGGGGTTGCCC
GCGCACTCCCTGGCCTGGGGACCTTGGGCCGAAGTGGGCATGGTGGCCGCGCGCTCCGAG
AGAAGCGCACACCTCGCGGCCCTTGGGATCGAGAGCATTCCTCCTGACGAGGGAGTGGCG
ATTCTCGGACGGCTCCTGCGCGCCGCGTCGGCGCATGTGGGCATCTTCCAGATCGATTGG
ACACGGTGGCAACAGCGCCATGCGGAGGGCCACGCTCCGCTGCTGGCCGGGATTCTCAAG
CAGCAGGCGGCGGCTCCATCGCAGGACTCTTCAGAAGAGGCCCCCGATATCCAGGAGCTG
ATCCGCGCGACCCCTGAGGAGCGTCAGAAGCGGGCCGAGGCTTTCCTGCGGCGAGAAGTG
ACCCGGATCCTGGACCTTCCCCGGCCCTTGGCCGATGGGCGTCTGCCGCTCGTCCGCTTC
GGCTTCGACTCCCTCATGAGCTTGAAGCTCAAGGCGCGGCTCGAGTCGACGCTCGGGCTC
TCTATTTCGGCCGCCAAGCTCTTGAGCGGCCTGAGTCTCGACAAGCTCGTGGCCCTTGTC
CTCGAGCGCATCGAGACCCTGCAGCCCACACCGGTTTCTACCGACGATCAAATGGAGGAT
TTCCGATTTTGA
[0] ACP17..86
[1] KS108..482
[1] AT558..872
[1] AT986..1302
[1] malonyl-CoA not conserved HAFHS(H->Y)1176..1180
[1] DH1344..1510
[1] KR1850..2029
[1] ACP2121..2191
[2] KS2220..2597
[2] AT2757..3073
[2] methylmalonyl-CoA2946..2950
[2] DH3117..3282
[2] KR3633..3812
[2] ACP3912..3981
[0] ACP49..258
[1] KS322..1446
[1] AT1672..2616
[1] AT2956..3906
[1] malonyl-CoA not conserved HAFHS(H->Y)3526..3540
[1] DH4030..4530
[1] KR5548..6087
[1] ACP6361..6573
[2] KS6658..7791
[2] AT8269..9219
[2] methylmalonyl-CoA8836..8850
[2] DH9349..9846
[2] KR10897..11436
[2] ACP11734..11943

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [549-680]  G3DSA:3.40.366.10 [749-864]  G3DSA:3.40.366.10 [984-1105]  G3DSA:3.40.366.10 [1174-1275]  G3DSA:3.40.366.10 [2754-2878]  G3DSA:3.40.366.10 [2946-3061]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1851-2016]  6.19999999999995e-57 PF00106 [3633-3799]  6.59999999999996e-57 PF00106
PF00106   adh_short
IPR009081 Acyl carrier protein-like (Domain)
 [10-124]  5.69999708783952e-20 SSF47336 [2114-2236]  2.90000354677981e-22 SSF47336 [3905-3983]  8.90000829418053e-12 SSF47336
SSF47336   ACP_like
 [19-85]  1.4e-07 PF00550 [2129-2189]  4.00000000000001e-11 PF00550 [3918-3980]  0.00019 PF00550
PF00550   PP-binding
 [15-89]  3.80000000000003e-36 G3DSA:1.10.1200.10 [2121-2194]  2.1e-37 G3DSA:1.10.1200.10 [3903-3983]  3.80000000000003e-36 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [17-86]  PS50075 [2121-2191]  PS50075 [3912-3981]  PS50075
PS50075   ACP_DOMAIN
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [108-356]  8.1e-95 PF00109 [2220-2471]  1.60000000000002e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [364-482]  3.99999999999998e-44 PF02801 [2480-2597]  2.59999999999998e-43 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [558-872]  2.70000000000002e-66 PF00698 [986-1302]  1.79999999999997e-78 PF00698 [2757-3073]  3.19999999999996e-76 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [555-846]  3.70001063537244e-45 SSF52151 [983-1286]  1.10000150671643e-62 SSF52151 [2755-3044]  1.3000049540733e-63 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [682-747]  1.89999859865864e-12 SSF55048 [1110-1175]  2.09999806691534e-16 SSF55048 [2880-2945]  4.60000044330862e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [108-367]  G3DSA:3.40.47.10 [368-532]  G3DSA:3.40.47.10 [2220-2481]  G3DSA:3.40.47.10 [2483-2650]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [100-534]  4.30000170645869e-99 SSF53901 [2212-2650]  6.10002656149838e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1850-2077]  4.69999999999992e-72 G3DSA:3.40.50.720 [3633-3847]  4.69999999999992e-72 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [269-285]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [559-856]  1.39999277195148e-83 SM00827 [987-1285]  7.40000780398351e-102 SM00827 [2759-3054]  1e-104 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [18-89]  5.50000546509999e-16 SM00823 [2122-2194]  3.0999994589937e-27 SM00823 [3913-3984]  4.39999967439747e-11 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1344-1510]  2.50000909916183e-42 SM00826 [3117-3282]  3.0999994589937e-30 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [110-534]  SM00825 [2222-2650]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1850-2029]  1.70000295590053e-61 SM00822 [3633-3812]  5.09998762524166e-61 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit