close all open/close all

CDS information : Myxo_00030


close this sectionLocation

Organism
StrainDW4/3-1
Entry nameMyxothiazol
Contig
Start / Stop / Direction13,537 / 17,409 / + [in whole cluster]
13,537 / 17,409 / + [in contig]
Location13537..17409 [in whole cluster]
13537..17409 [in contig]
TypeCDS
Length3,873 bp (1,290 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)MtaC
Gene
Gene (GenBank)mtaC
EC number
Keyword
Note
Note (GenBank)
  • peptide synthetase; peptide synthetase domains: Heterocyclisation, adenylation, PCP note: motif with weak homology to putative NAD binding proteins from Pyrococcus species located behind PCP; this motif may be involved in; thiazole formation from the proposed thiazoline intermediate of the biosynthesis of myxothiazol
Reference
ACC
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)

close this sectionPKS/NRPS Module

3
C20..315
A504..904
PCP990..1057

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [MtaC]
MIELLRPKEAVPDAARQFEPFPLTDIQETYFVGRGTDFGISGMSCHLYHELDTRGMDVAR
LSRAWQRLIEQHVMLRSVVLPTGEQRVLESVPPFSIPVLDLRGQAPALVETKLAEIRQQL
STRSTPPGQWPTFELRATLLDEGRTRIHFDFDAITADASAVLTLLEEWREFYLSPDRPLK
QVPVSFRDHVLAEVAARDTDSFRQAEAYWNARLNDMPDAPALPVATEPERLMRPSFRRLS
GRLDAARWARLKERAANAGLTASGVVCAAFAEVLGAWSESPRFTLNLTLFRRLPIHPEVD
RLLGDFTTNVLLEVDRSGESFTARAVRLRDQLAEDLEHTHFSGVRVMRQRAQMKKGNGAI
MPVVFTSLLGHRSRVPGGGSPFSWLGEVVYAITQTPQMWLDHQVREEAGALYCHWDSPEG
LFPEGLLEGAFEAYTDLLSRLADDNALWEEGTVVRLPEAQRARRETFNATTASIPEARLD
GLFLAQAEQGPQRMAILEPALRMSYGELLGQAGSLAAHLAELGARPNELTAVVLEKGWRQ
IVAVTAIHLAGSAYLPIDPALPEERRRLLLEEGQVKVVLTESHLAERLSWPASVRVVAIA
DTARGAPPRLPARAASDMAYCIYTSGSTGRPKGVKIEHRAAANTILDINERFGVGPADRV
FALSSLGFDLSVYDIFGSLAAGAAIVLPQPEVTRDPAHWLQVLRQQGVTIWNSVPTLMEM
LVDQVEARGELLPETLRLVMLSGDWIPVTLPDRIRRLSRDIRVISLGGATEASIWSIIHP
IGRVDPAARSIPYGRPMLNQRFYVLDEKLAPRPDHVPGDLYIGGVGLAQGYFRDEETTRA
RFFNHPRTGERLYRTGDLGRFLPEGEIEFLGRKDFQVKIAGHRIELGEIEAVLQRHPSIR
EAVVAAPGERTSRRLVAYLVPVEGQEAPSDEVLRSFLAAALPQYMVPAVFVRLEHLPLSS
NGKVDRKALPEPVLQPSRASGLTDARGGKILSAIMRLVSEVLKRPSIEPEAGLLQLGATS
VELIKLSMMLEQEFGSRPTITELLSLRNASEIAAYYVERQPAEEARKSDEAELVPAGIRR
FDAGAVTAQLEAPPEDEARRQCYFKRVSHRTFSAEPVEARVLARLLSCLSPLKVEGQLKY
QYGSAGGIYGVQTYLSIATGRVRGLDAGAYYYDPLRHTLVQLGGASALPAALDSSANAAM
ADSAAFSLYLVGDRRVISQRYGERWRDLALIEAGLMAQLLETRAAESDLGLCQLEELRFE
GLSKALRLEEEHMYLHGLVGGGLAWEEGAL
selected fasta
>non-ribosomal peptide synthetase [MtaC]
ATGATCGAATTGCTGCGCCCGAAGGAGGCCGTGCCGGATGCCGCGCGGCAGTTCGAGCCC
TTCCCCCTGACCGACATCCAGGAGACGTACTTCGTCGGCCGTGGCACCGATTTCGGCATC
AGCGGGATGTCTTGCCATCTGTACCATGAGCTCGACACCCGGGGGATGGACGTGGCCCGG
CTCTCGCGGGCCTGGCAGCGCCTCATCGAGCAGCACGTGATGCTGCGCTCCGTGGTGCTT
CCCACGGGTGAGCAGCGTGTGCTCGAGAGCGTTCCTCCGTTCTCCATTCCCGTGCTGGAC
CTGCGTGGGCAGGCCCCCGCGTTGGTGGAGACGAAGCTCGCGGAGATCCGGCAGCAGCTC
TCGACCCGCTCCACGCCCCCAGGACAGTGGCCCACCTTCGAGTTGCGCGCGACGCTTCTC
GATGAAGGACGGACACGCATCCACTTCGATTTCGATGCCATCACCGCGGATGCTTCCGCG
GTGCTCACCCTCCTGGAGGAGTGGCGCGAGTTCTACCTCTCGCCGGATCGGCCCCTCAAA
CAGGTGCCCGTCTCTTTCCGAGACCATGTGCTCGCGGAGGTCGCGGCCCGGGACACGGAT
TCATTCCGGCAGGCGGAGGCTTACTGGAACGCGCGGCTCAATGACATGCCGGACGCTCCG
GCGCTGCCTGTCGCCACCGAGCCCGAGCGTTTGATGCGTCCTTCATTCAGACGCCTGAGT
GGCCGTCTGGATGCAGCCCGCTGGGCAAGGCTGAAGGAGCGCGCCGCGAACGCGGGGCTG
ACCGCCTCGGGCGTTGTCTGCGCGGCGTTCGCGGAAGTACTTGGTGCCTGGAGTGAGTCG
CCTCGCTTCACCCTCAACCTCACGTTGTTCCGGCGCCTGCCGATCCACCCGGAAGTGGAC
CGGCTCCTGGGGGACTTCACCACCAACGTGCTGCTGGAGGTGGATCGAAGCGGTGAGAGC
TTCACCGCCCGGGCCGTGCGCCTCCGTGACCAGCTCGCCGAGGATCTCGAGCACACGCAC
TTCAGCGGGGTGCGGGTGATGCGGCAGCGTGCTCAGATGAAGAAGGGGAACGGGGCCATC
ATGCCCGTCGTCTTCACGAGCCTCCTCGGGCACCGGTCCCGAGTGCCAGGCGGGGGCTCC
CCGTTCAGCTGGCTGGGCGAGGTCGTCTACGCCATCACCCAGACGCCGCAGATGTGGCTG
GATCACCAAGTTCGTGAGGAAGCTGGAGCGCTTTACTGTCACTGGGACAGCCCAGAAGGT
CTCTTCCCGGAGGGGCTGCTTGAAGGGGCCTTCGAGGCCTACACGGATCTGCTGAGCCGA
CTCGCCGACGACAACGCCCTGTGGGAAGAGGGCACCGTGGTGCGGCTCCCCGAGGCCCAG
CGCGCTCGCCGTGAGACATTCAACGCCACCACAGCCTCCATTCCCGAGGCCCGCCTCGAT
GGACTTTTCCTGGCCCAGGCAGAGCAGGGGCCCCAGCGGATGGCCATCCTGGAGCCTGCG
CTGAGGATGAGCTACGGGGAGCTGCTCGGTCAGGCGGGCTCTCTCGCGGCCCACCTCGCC
GAGCTGGGTGCGCGGCCCAACGAGCTGACGGCCGTTGTTCTGGAAAAAGGTTGGCGGCAA
ATCGTCGCGGTGACGGCCATTCATCTGGCCGGATCCGCTTATCTCCCCATCGACCCTGCG
CTTCCCGAGGAGCGTCGCCGGCTTCTGCTCGAAGAAGGGCAGGTCAAAGTGGTCCTGACC
GAGAGCCATCTGGCGGAGCGGCTTTCGTGGCCGGCGAGCGTCCGGGTCGTGGCCATTGCC
GACACCGCTCGAGGAGCGCCGCCGCGCTTGCCTGCGCGTGCTGCCTCGGACATGGCGTAC
TGCATCTACACCTCGGGTTCGACGGGACGGCCCAAGGGGGTGAAGATCGAGCACCGGGCC
GCGGCGAACACGATTCTCGACATCAACGAGCGCTTCGGCGTGGGCCCGGCGGACCGTGTC
TTTGCTCTCTCGTCGCTCGGTTTCGACTTGTCGGTCTACGACATCTTCGGAAGCCTGGCG
GCCGGTGCCGCGATTGTCCTGCCCCAGCCTGAGGTCACCCGGGATCCCGCGCACTGGCTC
CAGGTGCTCCGTCAGCAGGGCGTGACCATCTGGAACTCGGTTCCGACGTTGATGGAAATG
CTCGTGGATCAGGTCGAGGCCCGGGGCGAGCTTCTCCCCGAGACCCTGCGGCTCGTGATG
CTGAGCGGTGACTGGATTCCCGTGACCTTGCCGGACCGCATCCGTCGGCTGTCCCGCGAC
ATCCGGGTCATCAGCCTCGGTGGCGCCACGGAAGCGTCAATCTGGTCGATCATCCACCCG
ATTGGCAGGGTGGATCCCGCGGCGCGCAGCATTCCGTACGGCCGTCCGATGCTGAACCAG
CGCTTCTACGTGCTCGATGAGAAGTTGGCGCCGCGTCCAGACCATGTGCCGGGCGACCTC
TACATTGGAGGGGTGGGGCTGGCGCAGGGCTATTTCCGCGATGAGGAGACGACGCGGGCG
CGTTTCTTCAACCATCCTCGCACCGGTGAGCGGCTCTACCGCACGGGCGATCTGGGGCGC
TTCCTTCCTGAAGGAGAGATTGAGTTCCTCGGCCGCAAGGACTTCCAGGTCAAGATTGCC
GGGCACCGCATCGAGCTCGGAGAGATCGAGGCCGTGCTCCAGCGTCACCCTTCGATCCGG
GAAGCGGTGGTCGCGGCCCCGGGTGAGCGGACCTCGCGGAGGCTCGTGGCCTATCTTGTT
CCTGTCGAGGGACAAGAGGCCCCCTCGGACGAGGTATTGAGGAGCTTCCTGGCCGCGGCC
CTGCCCCAGTACATGGTGCCTGCCGTCTTCGTCCGCTTGGAGCACCTGCCCTTGTCGTCC
AACGGCAAGGTGGATCGCAAGGCGCTGCCGGAGCCTGTGCTCCAGCCCTCGCGTGCCTCG
GGCCTCACGGATGCGCGGGGCGGGAAGATCCTCTCGGCCATCATGCGGCTGGTTTCGGAG
GTGTTGAAGCGCCCGTCGATCGAGCCGGAGGCGGGGCTTCTCCAGTTGGGAGCCACGTCG
GTTGAACTCATCAAGCTCTCGATGATGCTGGAGCAGGAGTTTGGAAGCCGCCCCACGATC
ACCGAGCTTCTCTCGCTTCGGAATGCTTCCGAGATCGCGGCCTACTACGTCGAGCGTCAG
CCAGCAGAAGAGGCACGCAAGAGCGATGAGGCGGAGCTGGTCCCTGCTGGCATCCGCCGC
TTCGACGCGGGAGCCGTGACGGCGCAACTGGAGGCGCCTCCCGAGGATGAAGCGCGGCGG
CAGTGCTACTTCAAGCGGGTCAGCCACCGGACCTTCTCCGCGGAGCCCGTGGAGGCCCGG
GTTCTCGCCCGGCTGCTGTCTTGTCTCTCGCCCCTCAAGGTGGAGGGACAGCTCAAGTAC
CAGTACGGCTCGGCGGGCGGAATCTACGGGGTACAGACCTACCTCTCGATTGCCACGGGA
CGTGTCCGGGGGCTCGACGCAGGCGCCTACTACTACGATCCGCTGCGTCATACGCTCGTC
CAGTTGGGGGGCGCGAGCGCGCTCCCGGCGGCGCTTGACTCGTCCGCCAACGCGGCCATG
GCCGATAGCGCGGCGTTCTCGCTCTACCTCGTTGGTGATCGGCGGGTCATCTCTCAGCGC
TACGGGGAGAGATGGCGGGATCTGGCGCTGATCGAAGCGGGTTTGATGGCGCAACTTCTC
GAGACGAGGGCCGCTGAGAGCGACTTGGGACTCTGCCAGCTCGAGGAACTGCGCTTCGAA
GGGTTGAGCAAGGCGCTCCGGCTCGAAGAGGAGCACATGTATCTCCATGGCCTCGTGGGT
GGCGGCCTCGCGTGGGAAGAGGGTGCCCTGTGA
[3] C20..315
[3] A504..904
[3] PCP990..1057
[3] C58..945
[3] A1510..2712
[3] PCP2968..3171

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000415 Nitroreductase-like (Domain)
 [1096-1129]  6.90000000000001e-10 G3DSA:3.40.109.10 [1164-1274]  6.90000000000001e-10 G3DSA:3.40.109.10
G3DSA:3.40.109.10   G3DSA:3.40.109.10
 [1105-1277]  3.90000000000001e-13 PF00881
PF00881   Nitroreductase
 [1097-1281]  2.49999811956465e-12 SSF55469
SSF55469   Nitroreductase
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [504-904]  4.69999999999992e-105 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [20-315]  1.40000000000001e-37 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [983-1065]  3.59999643435987e-11 SSF47336
SSF47336   ACP_like
 [990-1073]  1.4e-10 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [990-1057]  PS50075
PS50075   ACP_DOMAIN
 [993-1055]  4.6e-09 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [504-904]  1.39999999999997e-124 TIGR01733
TIGR01733   AA-adenyl-dom
IPR013624 Non-ribosomal peptide synthetase (Domain)
 [338-397]  7e-20 PF08415
PF08415   NRPS
SignalP No significant hit
TMHMM No significant hit