close all open/close all

CDS information : Myxo_00040


close this sectionLocation

Organism
StrainDW4/3-1
Entry nameMyxothiazol
Contig
Start / Stop / Direction17,406 / 27,281 / + [in whole cluster]
17,406 / 27,281 / + [in contig]
Location17406..27281 [in whole cluster]
17406..27281 [in contig]
TypeCDS
Length9,876 bp (3,291 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.3 PKS/NRPS hybrid
Productnon-ribosomal peptide synthetase/polyketide synthase
Product (GenBank)MtaD
Gene
Gene (GenBank)mtaD
EC number
Keyword
Note
Note (GenBank)
  • PKS/NRPS; MtaD module 1: peptide synthetase domains: heterocyclisation, adenylation, PCP note: motif with weak homology to putative NAD binding proteins from; Pyrococcus species located between adenylation core regions A9 and A10; this motif may be involved in thiazole formation from the proposed thiazoline intermediate of the biosynthesis of myxothiazol; similar to the motif found in MtaC; MtaD module 2: polyketide synthase domains: KS, AT, DH, KR, ACP
Reference
ACC
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)

close this sectionPKS/NRPS Module

4
5 malonyl-CoA
C77..373
A560..962
PCP1323..1390
KS1456..1833
AT1986..2302
DH2348..2520
KR2888..3067
ACP3163..3235

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase/polyketide synthase [MtaD]
MSTSEFIVYLQQKGIELWIEGDTLRFRAPPGHLTPELRTALKDKKEQLLEHLRSASRSAN
LQTVASPPDAASRFAPFPLTDIQNAYWVGRQGAFDAGGVAAHSYLELAFDTLDLPRLESI
LQRLIEYHDMLRMVVLPTGEQVVLEKVPPFTLTAYDLAGAPASQIEAHFEAIRGELSHQV
LPTDRFPLFDVRASKLAGGRVHLHISFDLLTADAFSVQILIEQCASLYLNPEAQLVPFKR
TFRDYCVLAAQRADPSSRAYQNSLAYWRNRLEKLPNAPDLPLVNDTDVKGQHQFVRRKAG
LDQASWRAFRNHAKAAGITASMALCAAYGETLRAYSRSNRLTLNLTLFNRLPLIEDVERI
VGDFTSGILLELDGSKPESFAARARRLQGQFINDLEHSAVSSVKVLREAIRLGRWDAGTA
MPYVFTSLISETGRSLSVSEGVKIVDVISQTPQVWLDHQVFELDGGIYYSWDSVDALFPA
GLIDAVFESYGRLLHRLSSDASAWDALSRQPLLPAQLASRAEYNATERPVSQERIESLFL
RQAERQPGAVAVIAGEQVLSYGKLERRSARIAAWLIAQGVKPDQLVAIVAEKGVEQVVAA
LAILRAGAAYLPLSPSLPPERLHALLEEAQADVVLTQSALESSLRWPEGPRRLSVDRDEF
LEAPKGALPPVQGNNLAYVIYTSGSTGRPKGVMIDHRGAVNTLLDMNERFNVGPRDRVLA
LSSLSFDLSVYDLFGVLAAGGAIVMPEPGTSRDPGRWQVLLEKTGVTIWNSVPALMDMLV
EFSEGSGLRLPDSLRLVLMSGDWIPVTLPGRIRALSKNAELVSLGGATEASIWSILYRIG
DVGAGWRSIPYGRPMVNQRFYVLDEALEPCPDWVAGQMYIGGIGLSLGYYRDPVRTAERF
IVHPKTGERLYATGDLGRFMPDGNIEFLGREDFQVKIQGYRIELGEIEAALDSHPAVRSS
VVNAVGKPGGTRRLVAYVVPGELTSNAPPASAPSASTLSLESAPKLADEYSALESQGAGL
ITDTVERLEFKLKQHNLRPDAGSRAQVALKKPEFDEAFRKRYMERQSAQSFLSEPVSLER
LSELLSCLMQIALEDSMMPKYRYASAGGLYPVQVYLHVKPGRVGGLAGGTYYYHPKRHEL
VLLTADAAMDRSQHASRNRPVFDAAAFSVFLVGKLSAIAPLYGSMARDFCMLEAGYMAQL
LMSVAPAHKMGLCPIGVMDFEPLRSQLALDEHHVLLHSFLGGGAVTAAAAAKPAPKAADA
SLPDELRRYLASKLPEYMVPSSFVLLDSLPLTSNGKVDRSALRAPAELVEVKPPAARAPG
SDVERSLAAIVQEVLQLQEVDVHRNFFDLGGTSVHIVQMHRRMKERLKADIPIAQMFRYT
TVSALAEFIHSQRVQAASPAPAPSPQTAPEVVAKAVEAPSPVREAVREEAAPRALSATGV
SKARDTASRPSTGRQEPVAIVGMSGRFPGAKNLGEFWRNLRDGVESISFLTERELRQSMD
DPSMLSDPSYVRASSSLEDVELFDADLFGFMPKQARITDPQHRIFMECVWEAIEDAGYNP
RKLDKLVGVYAGAIISNYLLFNLGPSVGREGAVRDLQTLIGNDKDYLATHVSYKLGLKGP
SLSVQSACSTSLVAVHLACQALVNKECDMALAGGVSVRLPQKSGYLFEQGGILSPDGHCR
AFDANAQGTIFGSGAGVVVLKRLSDALADGDNIRAVIRGSAINNDGSLKIGYTAPSQDGQ
AAVISAALAAAGVSPSTLGYIETHGTGTPLGDQIELSALQQVFGSSTGQASRCPIGSVKT
NVGHLEVAAGIAGLIKTVLSLQHRRLPPSLNFKQPNPQLESSTSSFYVNTQLSDWPAGEL
PRRAGVSSFGIGGTNAHVVLEEAPEPGRQVAERERPLHVLSLSARSEVALKALAGRYAQH
LASSGAVNLADVCHTANAGRAQFKHRLALVAESAAQLSQQLGLFAEGKPAEVLLGQAPNA
GKAEVVFLFTGQGSQHEGMGRELYETQPVYRESLKKSDELLRPVLNESLLEVLYGGKGHL
LEQSGVSQPALFAVEYALAQLWKSWGVKPAAVMGHSLGEYVAACVAGMCTQEEGLKVVAA
RGRLMEQLPEAGEMVAVLAAEAKVQEAVAPYAQSVSVAAVNGPEETVVSGRAAQVEQVVS
KLKEQGVDCRKLKTTHAFHSPLMEPMLEEFEKEAGKVKWKRPEIEVVSNVSGQLAKGEEG
QKGEYWKKHIRQPVKYWEGLKGLYEKGYRVFVEVGPKPTLVNVGKRNLPGGEAEWVGSLK
QGSNEWQQMLGSVAKLYVKGVGVDWAGFDQDYPRAKVALPTYPFQRERYWVERSRGAAAS
AVSSAGSRRLLGRRMSSPALKETVFESFVGTRALPFIDDHRVNGTVVLPATVYMEMAQAA
AVELFGAGPHTVESLLIHEALVLQDETERALQLVLTPGGEGEFSFQVFSAQGSPAEPQRE
ASWTLHTAGTIRRAEKATSQPKPMSIEGLQSWCAQTVPVTALYENFEARGITYGTTFRGV
QRLHVGRGEALGWIQLPEELNSEAVLAPIHPALLDACLQVCGATRLEEKVEAQADVLYLP
VGMKRFRIWQSPGAACWSHVSIQPQAAASEKMLTGSVRLLDASGEVCAEIEGLQFRQVSR
AALRRSIQVGREWTYDVSWEQRPRSGILEDAVLEGTWWVLADSAGVGTRLVEALQSHGAR
CVVVRPGPAYEARADRTFVLNPARVEDFERLLVDSQGPANLPCRGILHLWGLDEAPSLEA
AQELGCRSVLNLAQALGKSRLEVSPRLWIATRGTQRTGHETQPPSLTHAALWGLGRTLAV
EHPELSVALLDLDERAHASEDSLLIEEFLLDPDGEQVAFRNGRRYVSRLARCAVPNTQPS
ATRLREDVSYLLTGGLGAIGLHVARWMVERGARHLVMMGRTEAGSAAQEALQSLREAGAR
IRLEQGDVSQPGDVARVLASLAQSGPPLRGVMHLAGVVEDSMLQQQDWPRFKRVLAPKLQ
GSWNLHHQTKEMDLDFFVLFSSSSALLGAAGQGNYAAANAFLDSLAHHRRALGLKAVSIN
WGPWSGGGMAASFAGSEQRRWVDWIEPAQGLELLGWALDAAQAQVAVLPVDWAKYFQRFG
DTGATKFLSRLLEETRSGTAKARQPKLLERLKGLTRNRQQDVLLEYVYSQVTQVLGLDPS
RPLAGNQRLFEIGMDSLLAVELRNRFQSTLGVDRPLSSTLVFDHPTVEALTGYLAAEFLK
LGPVDPVSAQASKGEEAAAQTLANLEQLPQNELGSLLDEKLALLEKLMGDG
selected fasta
>non-ribosomal peptide synthetase/polyketide synthase [MtaD]
GTGAGCACGTCCGAGTTCATCGTCTATCTCCAGCAGAAGGGCATCGAACTGTGGATCGAA
GGGGACACGCTGCGATTCCGCGCGCCCCCTGGCCACCTCACGCCCGAGCTGCGCACGGCA
CTGAAGGACAAGAAGGAGCAGCTCCTGGAGCATCTGCGTTCCGCGAGCCGCTCCGCGAAT
CTTCAGACCGTGGCGAGCCCGCCGGATGCGGCGTCACGCTTCGCCCCTTTCCCGCTCACC
GACATCCAGAATGCCTACTGGGTGGGAAGGCAAGGTGCTTTCGATGCGGGCGGCGTCGCA
GCGCACAGTTACCTCGAGCTCGCGTTCGACACGCTCGATCTGCCGCGCTTGGAGAGCATC
CTTCAGCGGCTCATCGAGTACCACGACATGCTCCGCATGGTGGTGCTGCCGACGGGCGAG
CAGGTGGTGCTGGAGAAGGTGCCGCCGTTCACCCTCACCGCGTATGACCTTGCTGGGGCG
CCCGCCAGTCAGATCGAGGCGCATTTCGAGGCCATCCGCGGGGAACTCTCCCACCAGGTG
CTTCCGACGGACCGGTTCCCCCTGTTCGATGTCCGGGCCTCGAAGTTGGCCGGTGGACGG
GTTCACCTCCACATCAGCTTCGATCTCCTCACGGCCGATGCGTTCAGCGTCCAGATCCTG
ATCGAACAGTGCGCTTCGCTGTACCTGAATCCGGAAGCGCAACTGGTGCCCTTCAAGCGG
ACCTTCCGGGATTACTGCGTCCTGGCCGCCCAGCGCGCTGACCCGAGTTCCCGGGCCTAC
CAGAACTCGCTTGCGTACTGGCGAAACCGCCTCGAGAAGTTGCCCAACGCCCCCGATCTG
CCGCTCGTGAACGACACGGACGTGAAGGGGCAGCACCAGTTCGTGCGCCGGAAGGCAGGG
TTGGATCAGGCCTCCTGGCGCGCATTCCGCAATCATGCCAAGGCCGCGGGGATCACGGCG
TCCATGGCGCTGTGCGCCGCCTATGGGGAAACGCTGCGGGCCTACAGCCGGAGCAACCGG
CTCACGCTCAACCTGACCCTCTTCAACCGCCTGCCCTTGATCGAGGACGTGGAGCGGATC
GTCGGGGACTTCACCTCGGGAATCCTGCTCGAACTGGATGGCTCGAAGCCCGAGTCCTTC
GCCGCCCGGGCGCGGAGGCTCCAGGGGCAGTTCATCAATGATCTGGAGCACTCGGCTGTT
TCGAGCGTGAAGGTGCTGCGGGAAGCGATCCGCCTTGGCCGCTGGGATGCCGGGACCGCG
ATGCCCTATGTCTTCACGAGCCTCATCTCGGAGACCGGCCGCTCATTGAGCGTCTCCGAG
GGCGTGAAGATCGTCGACGTCATCTCCCAGACGCCCCAGGTGTGGCTCGACCACCAGGTT
TTCGAGCTGGATGGCGGCATCTATTACAGCTGGGATTCCGTCGATGCCCTCTTTCCCGCG
GGCCTGATCGACGCTGTCTTCGAGAGCTACGGAAGGCTCCTCCACCGTCTCTCCAGCGAT
GCCTCGGCGTGGGATGCACTCTCGAGGCAGCCGCTCTTGCCGGCCCAGTTGGCAAGCCGT
GCCGAGTACAACGCCACCGAGCGTCCCGTGTCGCAGGAGCGGATCGAATCGCTCTTCCTT
CGTCAGGCCGAGCGTCAACCCGGGGCCGTCGCGGTTATCGCGGGAGAGCAGGTTCTCTCC
TATGGCAAGCTCGAGCGCCGGTCGGCTCGGATCGCAGCGTGGCTCATCGCCCAGGGTGTC
AAGCCGGACCAGCTCGTGGCGATCGTTGCCGAGAAGGGGGTGGAGCAGGTGGTCGCCGCG
CTCGCCATCCTTCGCGCTGGAGCCGCCTACCTGCCGTTGTCTCCATCCCTGCCCCCCGAG
CGGCTCCACGCCTTGCTGGAAGAGGCGCAAGCCGACGTGGTGCTCACCCAGTCCGCCCTG
GAGTCGTCGCTGCGATGGCCCGAGGGGCCTCGTCGGCTTTCGGTGGATCGTGACGAGTTT
CTCGAAGCCCCGAAGGGGGCGCTGCCGCCGGTTCAGGGCAACAATCTGGCCTACGTCATC
TACACCTCGGGCTCGACGGGCCGTCCCAAGGGCGTGATGATCGACCACCGGGGAGCGGTG
AACACCCTCCTCGACATGAACGAGCGCTTCAATGTGGGGCCCCGGGACCGGGTGCTGGCG
CTTTCGTCACTCAGCTTCGACTTGTCTGTCTACGACCTCTTCGGAGTTCTTGCCGCGGGC
GGTGCGATCGTGATGCCGGAGCCCGGCACGTCGCGGGATCCCGGACGGTGGCAGGTGCTG
CTGGAGAAGACGGGGGTGACGATCTGGAACTCGGTCCCCGCGTTGATGGACATGCTCGTC
GAGTTCTCGGAGGGAAGCGGTCTGCGCTTGCCGGACTCGCTGCGCCTGGTCCTCATGAGC
GGTGACTGGATTCCGGTCACGCTGCCCGGCCGGATCCGTGCCCTGTCCAAGAACGCCGAG
CTGGTCAGCCTCGGTGGCGCGACCGAGGCCTCCATCTGGTCCATTCTCTACCGGATTGGC
GATGTGGGGGCCGGCTGGCGCAGCATTCCGTACGGTCGGCCCATGGTGAATCAGCGCTTC
TATGTGCTGGATGAGGCGCTGGAGCCCTGCCCGGACTGGGTCGCGGGCCAGATGTACATT
GGCGGCATTGGCCTCTCGCTCGGCTATTACCGGGATCCGGTTCGTACCGCCGAGCGCTTC
ATCGTCCATCCCAAGACCGGGGAGCGCCTGTACGCAACGGGTGACCTGGGCCGGTTCATG
CCGGACGGGAACATCGAGTTCCTCGGACGGGAGGACTTCCAGGTCAAGATCCAGGGCTAT
CGCATCGAGCTCGGGGAGATCGAGGCCGCGCTCGACTCGCATCCAGCGGTGCGCTCCTCG
GTGGTCAATGCCGTTGGAAAGCCCGGGGGGACTCGGCGCCTCGTGGCCTATGTCGTCCCT
GGGGAATTGACGTCGAATGCTCCCCCGGCAAGCGCGCCCTCGGCGAGCACGCTCTCCTTG
GAGTCGGCTCCGAAGCTTGCCGACGAGTACAGCGCTCTGGAGAGCCAGGGGGCTGGGCTG
ATCACCGATACGGTGGAACGCCTGGAGTTCAAGCTGAAGCAACACAACCTGCGCCCGGAT
GCAGGCAGCCGGGCTCAAGTTGCGCTCAAGAAGCCGGAGTTCGATGAGGCCTTCCGCAAG
AGGTACATGGAGCGGCAGAGCGCCCAGTCGTTCCTCTCCGAGCCCGTCTCTCTGGAGCGG
CTCAGCGAGTTGCTGAGCTGTCTGATGCAGATCGCTCTCGAAGACTCCATGATGCCCAAG
TACCGGTATGCATCGGCCGGTGGGCTCTATCCGGTGCAGGTCTACCTGCACGTCAAGCCA
GGGCGTGTCGGGGGGCTCGCGGGCGGGACCTACTATTATCACCCGAAGCGTCACGAGCTC
GTGCTGCTGACCGCGGATGCGGCCATGGACAGGAGCCAACACGCGTCCCGGAACCGGCCC
GTCTTCGATGCCGCCGCGTTCTCCGTTTTCCTCGTTGGAAAGCTGAGTGCCATCGCGCCG
CTGTACGGGAGCATGGCGCGGGATTTCTGCATGCTGGAGGCGGGCTACATGGCTCAGCTC
CTCATGAGCGTTGCCCCCGCCCACAAGATGGGTTTGTGCCCGATCGGCGTGATGGACTTC
GAGCCCCTGCGCTCGCAGCTCGCGTTGGACGAGCACCACGTGCTTCTGCACAGCTTCCTG
GGGGGCGGCGCAGTGACGGCGGCGGCTGCGGCCAAGCCAGCACCCAAGGCGGCGGATGCT
TCACTGCCCGACGAGTTGAGGCGTTACCTGGCGTCGAAGCTGCCGGAGTACATGGTTCCG
TCCTCGTTCGTTCTGTTGGATTCCCTTCCGCTGACGTCCAACGGCAAGGTGGATCGAAGC
GCGCTTCGTGCTCCGGCCGAACTGGTGGAAGTCAAGCCGCCCGCTGCGCGTGCGCCAGGC
TCGGACGTGGAACGTTCCCTGGCCGCGATCGTTCAAGAGGTGCTCCAACTGCAAGAGGTG
GATGTCCACCGCAACTTCTTCGATCTGGGGGGCACGTCGGTTCACATCGTGCAGATGCAT
CGCAGGATGAAGGAGCGGCTCAAGGCCGATATCCCGATCGCGCAGATGTTCCGGTACACC
ACCGTCAGTGCGCTGGCGGAGTTCATCCACAGCCAGCGAGTGCAGGCTGCTTCCCCCGCG
CCTGCTCCCTCGCCGCAAACTGCGCCCGAGGTGGTGGCAAAGGCGGTGGAGGCACCTTCA
CCGGTGAGGGAGGCCGTCCGTGAAGAGGCCGCTCCTCGGGCCTTGAGTGCGACGGGTGTG
TCCAAGGCGCGTGATACGGCCTCGCGGCCGTCCACTGGGCGGCAAGAACCGGTGGCCATC
GTGGGGATGTCTGGCAGGTTCCCGGGTGCGAAGAACCTCGGGGAGTTCTGGCGGAACCTG
CGTGATGGGGTCGAGTCGATCTCCTTCTTGACGGAGCGGGAGTTGCGGCAGTCGATGGAT
GATCCGTCGATGCTGAGCGATCCCAGCTACGTCCGGGCAAGCTCTTCCCTCGAAGATGTC
GAGCTTTTCGATGCGGACCTGTTTGGCTTCATGCCAAAGCAGGCGCGAATCACCGATCCC
CAGCACCGCATCTTCATGGAGTGTGTCTGGGAGGCGATTGAGGATGCGGGCTACAACCCG
CGCAAGCTCGACAAGCTGGTGGGCGTCTATGCGGGTGCCATCATCAGCAACTACCTCCTG
TTCAACCTCGGCCCTTCGGTGGGCCGGGAGGGGGCCGTGCGTGACCTGCAGACCTTGATC
GGAAACGACAAGGACTATTTGGCCACCCACGTGTCCTACAAGCTTGGGCTCAAGGGCCCC
AGCCTCAGCGTTCAGTCCGCTTGTTCCACCTCGCTCGTGGCCGTCCACCTGGCGTGCCAG
GCGCTGGTGAACAAGGAATGCGACATGGCGTTGGCCGGCGGAGTGTCCGTGCGGCTGCCG
CAGAAGTCGGGGTACCTCTTTGAGCAGGGAGGGATCCTGTCGCCGGATGGCCACTGCCGT
GCGTTCGATGCGAACGCCCAGGGAACGATCTTCGGAAGCGGCGCGGGGGTGGTGGTCCTC
AAGCGGCTGTCAGACGCGCTGGCGGACGGCGACAATATCCGTGCGGTGATCCGGGGCTCG
GCCATCAACAACGATGGCTCGCTGAAGATCGGTTACACGGCTCCCAGCCAGGATGGTCAG
GCTGCGGTGATCTCTGCGGCCCTGGCCGCAGCCGGCGTGAGCCCGTCCACCCTCGGTTAC
ATCGAGACCCACGGAACCGGGACGCCGCTGGGAGACCAGATCGAACTCTCTGCGCTCCAA
CAGGTATTTGGTTCCAGTACGGGGCAGGCCAGCCGCTGTCCCATCGGCTCGGTGAAGACG
AACGTTGGACACCTGGAAGTCGCCGCCGGCATCGCCGGATTGATCAAGACCGTGTTGAGC
TTGCAGCACCGCCGCTTGCCACCGAGCTTGAATTTCAAGCAGCCCAACCCACAGCTCGAG
TCCAGCACCAGCTCCTTCTACGTCAACACCCAGCTCTCTGACTGGCCGGCAGGCGAACTC
CCCCGCCGGGCTGGGGTGAGCTCCTTTGGCATTGGCGGTACGAACGCGCACGTGGTGCTG
GAAGAGGCTCCCGAGCCTGGTCGGCAGGTGGCGGAGAGAGAGCGTCCGCTGCACGTGCTG
AGTCTGTCAGCACGCAGTGAGGTAGCGCTGAAGGCCCTTGCGGGCCGGTACGCGCAGCAC
TTGGCATCGAGCGGAGCGGTGAACCTGGCGGATGTGTGCCACACGGCGAATGCAGGGCGC
GCGCAGTTCAAGCACCGGTTGGCGCTGGTGGCGGAGTCCGCCGCGCAGTTGAGCCAGCAG
CTAGGCCTGTTCGCCGAGGGTAAGCCCGCCGAGGTGCTGTTGGGACAAGCACCGAACGCA
GGAAAGGCGGAGGTGGTGTTCCTGTTCACGGGACAGGGAAGCCAGCACGAGGGGATGGGC
CGGGAGCTGTACGAGACGCAGCCGGTGTACCGGGAGAGCCTGAAGAAGAGCGACGAGCTG
CTGAGGCCAGTGCTGAACGAGTCGCTGCTGGAGGTGCTGTACGGAGGAAAGGGACACCTG
CTGGAGCAGAGCGGGGTGTCGCAGCCAGCGCTGTTCGCGGTGGAGTACGCGCTGGCGCAG
TTGTGGAAGAGCTGGGGAGTGAAGCCAGCGGCGGTGATGGGGCACAGCCTTGGAGAGTAC
GTTGCGGCGTGCGTGGCGGGGATGTGCACGCAGGAGGAGGGGCTGAAGGTTGTGGCGGCC
AGAGGGAGGCTGATGGAGCAGTTGCCGGAGGCGGGGGAGATGGTGGCGGTGCTGGCGGCG
GAGGCGAAGGTGCAGGAGGCAGTGGCGCCGTACGCGCAGAGCGTGTCGGTGGCGGCGGTG
AACGGCCCTGAGGAGACGGTGGTGTCTGGGCGAGCAGCGCAGGTGGAGCAGGTGGTGTCG
AAGCTGAAGGAGCAGGGAGTGGATTGCCGGAAGCTGAAGACGACGCACGCGTTCCACTCG
CCGCTGATGGAGCCGATGCTGGAGGAGTTCGAGAAGGAAGCAGGGAAGGTGAAGTGGAAG
AGGCCCGAAATAGAGGTTGTGTCGAACGTGAGCGGGCAGTTGGCGAAGGGGGAGGAGGGG
CAGAAGGGAGAGTACTGGAAGAAGCACATCCGGCAGCCTGTGAAGTACTGGGAGGGGCTG
AAGGGGCTGTACGAGAAGGGGTACCGTGTGTTCGTGGAGGTGGGGCCGAAGCCGACGTTG
GTGAACGTGGGGAAGAGGAACCTGCCGGGAGGGGAAGCGGAGTGGGTGGGCTCGTTGAAG
CAGGGGAGCAACGAGTGGCAGCAGATGCTGGGGAGCGTGGCAAAGCTGTACGTGAAGGGA
GTGGGAGTGGACTGGGCGGGGTTCGACCAGGACTACCCGAGGGCGAAGGTGGCGTTGCCC
ACCTATCCCTTCCAGCGCGAGCGATACTGGGTTGAACGCAGCCGCGGAGCGGCCGCGAGT
GCTGTGTCCAGCGCGGGCTCGCGCCGTCTGCTGGGTCGTCGCATGTCGTCCCCGGCCCTC
AAGGAGACGGTGTTCGAGTCCTTCGTCGGCACCCGTGCGTTGCCGTTCATCGATGACCAC
CGCGTGAACGGTACGGTGGTGTTGCCTGCCACCGTTTACATGGAGATGGCACAGGCCGCC
GCCGTGGAACTCTTTGGGGCCGGGCCTCACACCGTGGAAAGCCTGCTCATCCATGAAGCG
CTCGTCTTGCAGGACGAGACGGAGCGAGCGCTGCAACTCGTCCTCACGCCAGGAGGCGAG
GGCGAGTTCTCCTTCCAGGTCTTTAGCGCACAGGGCAGTCCTGCCGAGCCGCAGCGGGAA
GCATCCTGGACGCTGCATACAGCGGGGACGATTCGCAGGGCCGAGAAGGCCACTTCTCAG
CCGAAGCCAATGTCCATCGAGGGGTTGCAGTCATGGTGTGCCCAGACCGTGCCGGTCACG
GCGCTCTATGAGAATTTCGAGGCCCGAGGCATCACTTACGGAACAACCTTCCGAGGGGTT
CAGCGGCTCCACGTCGGCCGTGGAGAGGCGCTGGGCTGGATTCAGCTTCCGGAAGAACTG
AACTCGGAAGCAGTCCTTGCTCCCATTCATCCGGCGCTGCTCGATGCCTGCCTCCAGGTC
TGTGGCGCAACACGTCTGGAGGAGAAGGTGGAAGCACAGGCGGATGTGCTCTACCTGCCC
GTCGGAATGAAGCGATTCCGGATCTGGCAGTCCCCAGGTGCGGCTTGCTGGAGTCACGTT
TCGATTCAGCCTCAGGCGGCTGCATCCGAGAAGATGCTGACCGGAAGCGTGCGCCTCCTG
GATGCCTCGGGTGAGGTGTGCGCCGAGATCGAGGGATTGCAGTTCCGGCAGGTGAGCCGC
GCCGCGTTGCGGCGGTCCATCCAAGTGGGACGCGAGTGGACCTATGACGTGAGCTGGGAG
CAGCGCCCGCGCAGCGGCATTCTGGAGGATGCCGTCCTGGAGGGCACCTGGTGGGTGCTC
GCCGATTCGGCCGGTGTTGGGACTCGGTTGGTGGAGGCCCTGCAATCCCATGGGGCGCGC
TGCGTGGTGGTGCGTCCGGGACCGGCTTATGAGGCTCGGGCAGATCGCACGTTTGTCCTC
AACCCGGCGCGCGTGGAGGATTTCGAGCGCCTGCTCGTGGACTCTCAGGGACCCGCCAAC
CTCCCTTGTCGCGGCATCCTCCATCTGTGGGGGCTCGATGAGGCTCCGTCCTTGGAGGCG
GCGCAGGAACTGGGTTGCAGAAGCGTCCTGAACCTTGCCCAGGCCCTTGGCAAGAGCCGC
CTCGAGGTGTCGCCGCGGCTCTGGATCGCGACGCGCGGCACCCAGCGCACGGGACACGAG
ACGCAGCCTCCTTCGCTCACACACGCGGCACTGTGGGGCCTTGGCCGCACCCTCGCTGTT
GAGCATCCCGAACTCTCGGTTGCGCTGCTGGACCTCGACGAGCGCGCACACGCCAGTGAG
GATTCCCTCCTGATCGAGGAGTTTCTCCTCGACCCGGATGGAGAGCAGGTCGCCTTCCGG
AATGGGCGGCGCTATGTCTCTCGCCTCGCCCGCTGTGCTGTCCCGAACACGCAGCCATCG
GCCACCCGGTTGAGGGAAGACGTGAGCTACCTGCTCACGGGTGGATTGGGCGCCATTGGC
CTGCACGTCGCGCGGTGGATGGTGGAGCGGGGGGCACGCCATCTCGTCATGATGGGACGT
ACAGAGGCGGGCAGCGCTGCGCAGGAGGCGCTCCAGTCTCTGCGGGAAGCCGGGGCTCGG
ATCCGGCTTGAGCAGGGCGATGTCTCCCAGCCCGGAGACGTGGCCCGGGTGCTTGCCTCC
CTGGCCCAGAGCGGGCCGCCGCTGCGAGGTGTCATGCACCTGGCCGGCGTGGTGGAGGAC
AGCATGTTGCAGCAGCAGGACTGGCCTCGCTTCAAGCGAGTGCTCGCGCCCAAGCTGCAA
GGCAGCTGGAATCTGCACCACCAGACGAAGGAGATGGATCTGGACTTCTTCGTGCTGTTC
TCGTCCTCGTCCGCGCTGCTGGGCGCCGCGGGCCAGGGCAACTATGCCGCCGCGAACGCC
TTCCTGGATTCTCTCGCCCATCACCGGCGGGCGCTGGGACTCAAGGCGGTGAGCATCAAC
TGGGGCCCCTGGAGCGGCGGCGGCATGGCGGCTTCCTTCGCTGGCTCGGAGCAGCGGCGC
TGGGTGGACTGGATCGAGCCCGCTCAGGGGTTGGAGCTGCTGGGCTGGGCCTTGGACGCG
GCGCAGGCGCAGGTGGCGGTCCTCCCCGTCGACTGGGCAAAGTACTTCCAGCGATTCGGA
GATACCGGAGCGACGAAGTTCCTATCGAGGCTGCTGGAGGAGACGCGAAGCGGCACGGCC
AAGGCCCGGCAGCCCAAGCTGCTGGAGCGCTTGAAGGGGTTGACGCGGAACAGGCAGCAA
GACGTCCTGCTGGAGTATGTCTACAGCCAGGTCACCCAGGTGCTGGGCCTGGATCCCTCC
AGGCCGCTCGCGGGCAATCAGAGGTTGTTCGAGATCGGCATGGACTCGCTGCTGGCCGTG
GAACTGCGCAACCGGTTCCAGTCGACCCTGGGCGTGGACCGCCCCCTGTCCTCCACCCTG
GTCTTCGACCACCCGACCGTCGAGGCCCTCACTGGGTATCTGGCTGCGGAGTTCCTCAAG
CTGGGGCCCGTGGACCCCGTGTCTGCACAGGCGTCCAAGGGAGAGGAGGCCGCGGCTCAG
ACGCTCGCAAACCTCGAACAACTCCCGCAGAACGAACTGGGCTCACTCCTCGATGAGAAG
CTCGCGCTGCTCGAAAAGCTGATGGGAGACGGTTAG
[4] C77..373
[4] A560..962
[4] PCP1323..1390
[5] KS1456..1833
[5] AT1986..2302
[5] malonyl-CoA2176..2180
[5] DH2348..2520
[5] KR2888..3067
[5] ACP3163..3235
[4] C229..1119
[4] A1678..2886
[4] PCP3967..4170
[5] KS4366..5499
[5] AT5956..6906
[5] malonyl-CoA6526..6540
[5] DH7042..7560
[5] KR8662..9201
[5] ACP9487..9705

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000415 Nitroreductase-like (Domain)
 [1063-1237]  3.7e-15 PF00881
PF00881   Nitroreductase
 [1056-1236]  1.4e-11 G3DSA:3.40.109.10
G3DSA:3.40.109.10   no description
 [1056-1236]  1.8e-18 SSF55469
SSF55469   FMN-dependent nitroreductase-like
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [560-962]  1.9e-109 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [2175-2291]  3.3e-81 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR001242 Condensation domain (Domain)
 [77-373]  7.5e-43 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [3191-3206]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1316-1472]  7.3e-22 SSF47336 [3156-3272]  1.8e-16 SSF47336
SSF47336   ACP-like
 [1327-1389]  2.2e-11 PF00550 [3168-3234]  6.8e-10 PF00550
PF00550   PP-binding
 [1314-1393]  9.3e-22 G3DSA:1.10.1200.10 [3157-3236]  1.7e-12 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1323-1390]  19.386 PS50075 [3163-3235]  17.743 PS50075
PS50075   ACP_DOMAIN
IPR010071 Amino acid adenylation domain (Domain)
 [560-962]  1.1e-127 TIGR01733
TIGR01733   AA-adenyl-dom: amino acid adenylation domain
IPR013624 Non-ribosomal peptide synthetase (Domain)
 [397-453]  2.3e-11 PF08415
PF08415   NRPS
IPR013968 Polyketide synthase, KR (Domain)
 [2889-3066]  6.1e-71 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1456-1706]  1.9e-70 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1715-1833]  9.8e-42 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1986-2302]  3.9e-74 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1984-2290]  2.4e-72 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [2110-2175]  4.9e-15 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [1458-1718]  2.5e-75 G3DSA:3.40.47.10 [1719-1885]  3.1e-63 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [1448-1885]  9.3e-84 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2889-3090]  2.7e-40 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1619-1635]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020051 SagB-type dehydrogenase domain (Domain)
 [1078-1236]  1.5e-24 TIGR03605
TIGR03605   antibiot_sagB: SagB-type dehydrogenase domain
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1988-2283]  3.6e-110 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1321-1393]  2.2e-06 SM00823 [3164-3238]  5.8e-19 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2348-2520]  1.5e-46 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [1458-1885]  5.2e-182 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2888-3067]  3.4e-61 SM00822
SM00822   no description
IPR020845 AMP-binding, conserved site (Conserved_site)
 [679-690]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit