close all open/close all

CDS information : Myxo_00050


close this sectionLocation

Organism
StrainDW4/3-1
Entry nameMyxothiazol
Contig
Start / Stop / Direction27,340 / 33,183 / + [in whole cluster]
27,340 / 33,183 / + [in contig]
Location27340..33183 [in whole cluster]
27340..33183 [in contig]
TypeCDS
Length5,844 bp (1,947 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)MtaE
Gene
Gene (GenBank)mtaE
EC number
Keyword
Note
Note (GenBank)
  • PKS; polyketide synthase domains: KS, AT, O-Methyltransferase, KR, ACP
Reference
ACC
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)

close this sectionPKS/NRPS Module

6 methylmalonyl-CoA
not conserved YASHS(Y->V)
KS37..415
AT575..892
OM991..1262
KR1528..1721
ACP1821..1890

close this sectionSequence

selected fasta
>polyketide synthase [MtaE]
MSSSVEQHEHSARLARALVALEKMQAKLEASEREKREPVAIVGMACRFPGGGNDPKAFWD
LLREGRDTIVEVPPDRWDLEAYYDPDPDALGKMYTRWGGFLQNVRLDELDARFYGIAPRE
VASMDPQHRLMLEVTWEALANAGQVPERLANSLTGVFVGVMLNDYAQLQMKQADPTLLDA
YMALGNDSSFMAGRISYILGAQGPSMAVNTACSSSLVSVHLACQSLRSRECNMAIAGGVS
VILAPDGHIVSSRLRSQSPQGRCKTFDASADGYVRGEGCGVVVLKRLSDAIADGDPVLAV
IRGGAVNHDGPSGGLTVPSGPAQEAVIRRALASAGVEPSQVSYVEAHGTATPLGDPIEIR
ALQRVFEEGRTQAQPLTIGSVKTNVGHLEAAAGIAGLIKVVLMLQHREIPPHLHLTKPTP
AIPWNQLPITIPTQLQSWAGGSGQRVAGISSFGLSGINAHLVVEEAPAQVQRRAEEPSAA
RSAYLLPLSARSEPALQELARSYQAFLASGGEGANLRLDDICYTASTRRSHYEHRLAVTG
STREALVEHLGAFLKGEPHPAFSYREASLRRPKVVFVFSGQGSQWPRMGRELLRTSPVFR
KALEECDQAFRAHVDWSLLEQLGADESSSRMADIDVLQPVLFAVSVSLAAKWRSWGIEPD
AVVGHSMGEVAAAYVAGVLSLEDAAKVICLRSALLRRIRGHGAMALVEISLSQARTALAG
HEDRLSIAASNSPTSTVLAGDPQALQEVMAHLQRQNIFCRNVKVDVASHSPQVEPLLAEL
RDVLKDLRPKAASVPVFSTVTGKATDGTDWDAAYWQRNLREPVLFSPVIEQLLSPQHPVF
LELSPHPILLQSVERTARAAQQVGIALPSLRRDEAEVEVMLQSLGALHTAGHPIDWRAQY
PEARQSIPLPSYPWQRSRFWVDLKRAADFHPAAPRTHAPEGALVAGGGRSSHPEAAQPAH
ADGTPSRFYDDSVERERVLKPDEVYLTFGILRQKLPGFSWLMSVYGLSEREEHTEVLLNG
QRGLRSVLFRGVDWSSVRKVLDFGCGYASDLISLGKKHPHLTLHGYTISAEQAAIDEERV
RARGLQDRIRVFARDSAKDAFPDRYDLIFGFEVVTHIADKVALFSNISRNLQNGGFLLLA
DFIANSVSAINVQETASYNVNAEEWAELLARHNLRVVESVDISLEASHFLEDPGFDGHLD
TVSKRFGLTELVRRNFDAMRNFGKALEKGLMSYALIIIQKDDFANRPYLKRANRAKLGAL
TPLTEFEDGGAWAAPSEGADLEHVAPQALREWVYEVAWPEKKHAPRSEAQSQGADTGKWL
VLADGRGLGDALATRLREQGAPCTVLRAGGEASGPGQLSVNPKDPAEWQRVLGQLEAEGP
FRNVVHLWSLDSGSQAASSVAVLEETLRLGCGSLPLLVQRLSRGSGQKAKLWLVTRGTQA
VGKEAVSVAQAPLWGAGRVLALEHPEMWGGLVDLSPEAPAHELEALWQELRMPDGEDQIA
YRGAKRHVARLVRSDVTPESPATWRDDGAYLITGGLGALGLQVSRWLVSKGARHLILASR
SGLPDPGQWGSLPAESPFHSQVKAVQELQSMGASVQVVRCDVGEQAQVASLIEGIRKGSV
PLLGIFHAAGVSTHRSWQETDPELFSTVFRPKAAGAWLLHEYTRDMPLSCFVMFSSASAV
WGAQGMAAYAAANHALDALAHLRRSQGLAATSINWGRWTEGGMAGSEEAKRFFSQIGLEA
MPTEAALALLGRLAGSKAAQRVVASVEWSRFKPLQEAKRQRPFLENIVTAQPVQKAAAGN
ARSELLLRLEEAPSSRRRAILMDHVRVEVARVLGAEPSRLEPQQGFFQMGMNSLMSIELK
KHLETSLRHGLPSTIAFEYPTVEAMTGFLAKEVPALAALLSAPSEAASQDAALVDSDILD
LLGEAGRLSESELRDLAHSFPGDGSHE
selected fasta
>polyketide synthase [MtaE]
ATGAGCAGTTCCGTGGAACAGCACGAGCACAGTGCGCGCCTGGCGCGCGCGCTGGTGGCG
CTGGAGAAGATGCAGGCCAAGCTCGAGGCAAGTGAGCGCGAGAAGAGAGAGCCCGTGGCC
ATCGTTGGGATGGCGTGCCGGTTCCCGGGTGGAGGGAATGATCCGAAGGCGTTCTGGGAC
CTCTTGCGCGAGGGCCGGGACACCATCGTCGAGGTTCCTCCCGACCGATGGGATCTCGAG
GCCTATTACGATCCGGATCCCGATGCCCTGGGGAAGATGTACACCCGCTGGGGTGGGTTC
CTGCAGAACGTCCGGCTCGACGAGCTCGATGCCCGCTTCTACGGCATCGCGCCCCGGGAA
GTGGCGAGCATGGACCCCCAGCATCGCCTGATGTTGGAGGTGACCTGGGAGGCGTTGGCC
AATGCAGGACAGGTCCCGGAGCGGCTCGCGAACAGCCTCACCGGCGTGTTCGTGGGGGTC
ATGCTCAATGACTATGCCCAGCTCCAGATGAAGCAGGCAGACCCCACCTTGCTGGATGCC
TATATGGCGCTCGGCAACGACTCCAGCTTCATGGCGGGCCGCATCTCCTACATCCTGGGC
GCCCAGGGACCCAGCATGGCGGTCAACACGGCGTGCTCCTCCTCGCTCGTGTCGGTCCAC
CTGGCGTGCCAGAGCCTGCGCTCCCGCGAGTGCAACATGGCCATCGCGGGAGGCGTGAGC
GTCATCCTGGCGCCGGATGGGCACATCGTGTCGTCCCGCCTGCGCTCGCAGTCGCCTCAG
GGGCGCTGCAAGACCTTCGACGCCTCCGCGGATGGCTACGTCCGGGGAGAGGGCTGTGGC
GTCGTGGTGCTCAAGCGGCTCTCGGACGCCATCGCCGACGGCGATCCCGTGCTGGCGGTG
ATTCGCGGGGGCGCGGTGAACCACGATGGCCCCAGCGGTGGTTTGACGGTTCCCAGTGGG
CCTGCCCAGGAGGCGGTGATCCGCCGGGCGCTCGCCAGCGCGGGGGTGGAGCCCTCCCAG
GTGAGCTATGTCGAGGCCCACGGGACGGCCACCCCCCTGGGCGATCCCATCGAGATCCGG
GCCTTGCAGCGGGTCTTCGAGGAGGGGCGTACCCAGGCTCAGCCGCTCACCATCGGCTCC
GTCAAGACCAACGTTGGACACCTGGAGGCGGCGGCGGGAATCGCCGGGCTGATCAAGGTG
GTGCTGATGCTCCAGCACCGGGAGATCCCGCCCCATCTCCACCTGACGAAGCCCACTCCG
GCCATTCCCTGGAACCAGCTGCCCATCACCATTCCCACGCAGTTGCAGTCCTGGGCGGGT
GGCTCCGGGCAGCGCGTGGCAGGCATCAGCTCGTTCGGCCTGAGCGGCATCAACGCACAC
CTCGTTGTCGAGGAGGCTCCGGCGCAAGTTCAAAGGCGCGCGGAGGAACCTTCCGCGGCG
CGTTCGGCCTATCTCCTGCCGCTGTCAGCGCGCAGTGAGCCGGCGCTGCAAGAGCTTGCC
CGCTCCTACCAGGCGTTCCTGGCCAGCGGGGGCGAGGGGGCGAACCTCCGCCTCGATGAC
ATCTGCTACACGGCCAGTACCCGGCGCAGCCACTACGAGCACCGTCTGGCCGTGACCGGG
AGCACGCGCGAAGCACTCGTGGAGCACCTGGGTGCGTTTCTCAAGGGAGAGCCGCATCCC
GCGTTCTCGTACCGTGAAGCCTCCCTTCGGAGGCCGAAGGTGGTGTTCGTGTTCTCCGGG
CAGGGCTCTCAGTGGCCCCGCATGGGGCGGGAGCTTCTCCGGACCTCGCCGGTGTTCCGC
AAGGCACTCGAGGAATGCGACCAGGCCTTCCGGGCCCATGTGGACTGGTCTCTCCTGGAG
CAACTGGGCGCGGATGAGTCCTCGTCCCGGATGGCGGACATCGATGTTCTGCAGCCGGTG
TTGTTTGCCGTCTCGGTCTCGCTGGCCGCGAAGTGGCGCTCCTGGGGCATCGAGCCGGAT
GCCGTGGTGGGACACAGCATGGGCGAGGTGGCCGCCGCCTATGTCGCCGGGGTTCTCAGC
CTGGAGGACGCCGCGAAGGTCATTTGTCTGCGGAGCGCGCTGCTCCGGCGGATCCGTGGC
CACGGCGCGATGGCACTCGTGGAAATCTCTCTCTCCCAGGCGCGAACCGCGCTGGCGGGC
CATGAGGATCGCCTCTCCATCGCGGCGAGCAACAGCCCAACGTCCACGGTGCTGGCGGGC
GACCCACAGGCCTTGCAAGAGGTGATGGCCCACTTGCAGCGGCAGAACATCTTCTGCCGC
AACGTCAAGGTCGACGTCGCCTCGCACTCTCCCCAGGTGGAGCCTCTGCTGGCGGAGCTG
CGAGACGTGCTCAAGGACCTTCGCCCCAAGGCGGCGAGTGTGCCCGTGTTTTCCACGGTC
ACGGGCAAGGCGACGGACGGCACGGACTGGGATGCGGCCTACTGGCAGCGCAACCTCCGC
GAGCCTGTCCTGTTCTCGCCCGTCATCGAGCAGCTTCTCTCTCCGCAGCACCCCGTCTTC
CTGGAGCTGAGCCCCCATCCCATCCTGTTGCAGTCCGTCGAGCGGACCGCACGCGCCGCC
CAGCAAGTGGGCATCGCGCTGCCGTCCCTGCGGCGTGACGAGGCAGAGGTGGAGGTCATG
TTGCAGTCGCTCGGCGCCCTGCACACCGCGGGTCACCCGATCGACTGGCGGGCGCAATAT
CCCGAGGCCCGCCAGAGCATCCCCCTGCCTTCCTACCCCTGGCAGCGCTCGCGGTTCTGG
GTGGACTTGAAGCGGGCGGCGGACTTCCATCCCGCCGCGCCCCGGACGCATGCCCCGGAA
GGGGCCCTGGTGGCCGGGGGCGGACGCTCCTCGCACCCGGAGGCGGCACAGCCCGCGCAT
GCCGATGGGACGCCTTCGCGCTTCTACGATGACTCCGTGGAGCGTGAGCGGGTGCTCAAG
CCGGATGAGGTCTACCTGACCTTCGGAATCCTGCGGCAGAAGCTCCCAGGCTTCTCCTGG
CTCATGAGCGTGTATGGCCTCTCGGAGCGCGAGGAGCACACCGAGGTGCTGCTCAATGGT
CAGCGGGGGCTGCGCTCGGTGCTGTTCCGGGGCGTCGACTGGTCCTCGGTGCGCAAGGTG
CTCGACTTCGGGTGCGGGTATGCCTCCGACTTGATTTCGCTTGGCAAGAAGCACCCGCAC
CTCACCCTGCACGGTTACACCATCTCCGCCGAGCAGGCCGCCATCGACGAGGAGCGGGTC
CGCGCACGTGGGCTTCAGGACCGCATCCGTGTCTTCGCGCGGGACAGCGCCAAGGACGCG
TTTCCGGACCGTTACGATCTGATCTTCGGGTTCGAGGTCGTCACCCACATCGCCGACAAG
GTGGCGCTGTTCTCGAACATCTCCCGGAATCTTCAGAACGGTGGGTTCTTGCTCCTCGCG
GACTTCATCGCCAACAGCGTGTCGGCGATCAACGTCCAGGAGACCGCCTCGTACAACGTC
AACGCCGAGGAGTGGGCGGAGCTACTGGCCCGGCACAACCTGCGCGTGGTGGAGAGTGTC
GATATCAGCCTGGAGGCCTCCCACTTCCTGGAGGACCCTGGGTTCGATGGACACCTCGAT
ACCGTGTCCAAGCGCTTCGGGCTCACCGAGCTGGTGCGGCGCAACTTCGATGCCATGCGC
AACTTCGGCAAGGCGCTCGAGAAGGGGCTGATGAGCTATGCCCTGATCATCATCCAGAAG
GATGACTTCGCCAACCGGCCGTACCTCAAGCGCGCCAACCGCGCGAAGCTGGGGGCCCTG
ACGCCGCTCACGGAGTTCGAGGATGGAGGCGCGTGGGCGGCTCCCTCGGAAGGCGCGGAC
CTCGAGCACGTGGCCCCGCAGGCGTTGCGCGAGTGGGTGTACGAGGTGGCCTGGCCAGAG
AAGAAGCATGCGCCTCGGTCCGAGGCGCAGTCCCAGGGCGCGGACACGGGTAAGTGGTTG
GTGCTCGCCGACGGCCGCGGCTTGGGCGATGCGCTGGCCACCCGGCTGCGGGAACAGGGG
GCGCCTTGCACGGTGCTCCGCGCGGGAGGGGAGGCTTCGGGTCCAGGACAGCTCAGCGTC
AACCCGAAGGACCCTGCGGAATGGCAGCGGGTGCTTGGCCAGCTCGAAGCCGAGGGGCCC
TTCCGGAACGTGGTGCACCTGTGGAGCTTGGACAGCGGAAGCCAGGCGGCTTCCAGCGTG
GCCGTGCTGGAAGAAACGCTGCGGCTTGGATGCGGAAGCCTGCCTTTGCTGGTGCAGCGT
CTGAGCCGTGGCTCAGGTCAGAAGGCCAAGCTGTGGCTGGTGACCCGGGGAACCCAGGCC
GTGGGCAAGGAGGCGGTCTCCGTTGCGCAAGCGCCTTTGTGGGGCGCGGGGCGCGTGCTC
GCTCTGGAACACCCCGAGATGTGGGGTGGGCTGGTGGACCTCTCTCCGGAGGCTCCGGCC
CATGAACTCGAAGCGCTCTGGCAAGAGTTGCGGATGCCGGACGGGGAGGATCAGATCGCT
TACCGCGGTGCCAAGCGGCACGTGGCCCGGTTGGTGCGCAGCGACGTGACCCCGGAGAGT
CCCGCCACGTGGCGAGACGATGGGGCGTATCTGATCACCGGAGGCTTGGGAGCGCTGGGG
CTTCAGGTCTCCCGGTGGCTGGTGTCCAAGGGCGCCCGCCACCTGATCCTGGCAAGCCGC
AGCGGGCTGCCTGATCCAGGCCAGTGGGGCAGCTTGCCCGCGGAAAGTCCCTTCCACTCG
CAGGTCAAGGCCGTCCAGGAACTCCAGTCGATGGGGGCCTCGGTTCAAGTCGTCCGCTGT
GACGTTGGGGAGCAAGCCCAGGTGGCTTCGCTGATCGAGGGGATTCGCAAGGGGTCAGTG
CCCCTGCTGGGCATCTTCCACGCGGCGGGTGTCTCGACGCACCGGAGCTGGCAGGAGACC
GATCCGGAGCTGTTCTCCACGGTGTTCCGTCCGAAGGCCGCAGGGGCCTGGCTGTTGCAC
GAGTACACCCGGGACATGCCGCTCTCGTGCTTCGTCATGTTCTCCTCGGCCTCGGCCGTG
TGGGGCGCTCAGGGAATGGCCGCCTATGCCGCGGCGAACCATGCCCTCGATGCGCTGGCC
CACCTTCGGCGCTCGCAAGGGCTCGCCGCGACGAGCATCAACTGGGGACGCTGGACCGAA
GGCGGCATGGCGGGCTCCGAAGAGGCGAAGCGGTTCTTCTCGCAGATCGGCCTCGAGGCC
ATGCCCACCGAAGCGGCGCTGGCCCTGCTGGGGCGCCTCGCCGGGTCGAAGGCTGCTCAG
CGGGTGGTGGCTTCCGTGGAGTGGAGCCGCTTCAAGCCCCTTCAGGAGGCCAAGAGGCAG
CGGCCGTTCCTCGAGAACATCGTCACGGCGCAGCCCGTGCAGAAGGCGGCTGCCGGGAAC
GCCCGCTCCGAGTTGCTGCTCCGCTTGGAGGAGGCCCCTTCGAGCAGGCGCCGCGCCATC
TTGATGGACCATGTGCGCGTGGAGGTGGCGCGCGTTCTGGGGGCGGAGCCCTCCCGGCTG
GAGCCGCAGCAGGGCTTCTTCCAGATGGGCATGAACTCGCTCATGTCCATCGAGCTGAAG
AAGCACCTCGAGACGAGCCTGAGGCATGGGCTGCCGTCCACGATTGCATTCGAGTACCCC
ACCGTGGAGGCGATGACGGGTTTCCTGGCCAAGGAGGTGCCCGCGCTCGCGGCGCTCCTC
TCCGCGCCTTCGGAAGCGGCCAGTCAGGACGCAGCCCTGGTGGACAGCGACATTCTTGAT
CTGTTGGGTGAAGCGGGCCGGCTCTCCGAGTCCGAGCTCCGCGATCTCGCCCATTCTTTC
CCTGGAGACGGTTCACATGAGTGA
[6] KS37..415
[6] AT575..892
[6] methylmalonyl-CoA not conserved YASHS(Y->V)766..770
[6] OM991..1262
[6] KR1528..1721
[6] ACP1821..1890
[6] KS109..1245
[6] AT1723..2676
[6] methylmalonyl-CoA not conserved YASHS(Y->V)2296..2310
[6] OM2971..3786
[6] KR4582..5163
[6] ACP5461..5670

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [765-883]  1.6e-78 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR009081 Acyl carrier protein-like (Domain)
 [1814-1911]  3.6e-17 SSF47336
SSF47336   ACP-like
 [1825-1888]  1.3e-09 PF00550
PF00550   PP-binding
 [1821-1890]  16.511 PS50075
PS50075   ACP_DOMAIN
 [1821-1893]  3.6e-12 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
IPR013968 Polyketide synthase, KR (Domain)
 [1528-1720]  1.6e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [37-290]  2e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [298-415]  2.2e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [575-892]  6e-98 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [573-875]  5e-71 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [700-765]  3e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [39-302]  1.3e-98 G3DSA:3.40.47.10 [303-469]  4.9e-63 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [29-414]  4.9e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1765-1766]  2.3e-37 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [203-219]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [577-874]  1.2e-118 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020803 Polyketide synthase, methyltransferase domain (Domain)
 [991-1262]  2.5e-181 SM00828
SM00828   Methyltransferase in polyketide synthase (P
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1822-1893]  4e-17 SM00823
SM00823   Phosphopantetheine attachment site
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [39-468]  6.4e-221 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1528-1721]  4.9e-52 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit