close all open/close all

CDS information : Myxo_00060


close this sectionLocation

Organism
StrainDW4/3-1
Entry nameMyxothiazol
Contig
Start / Stop / Direction33,188 / 37,270 / + [in whole cluster]
33,188 / 37,270 / + [in contig]
Location33188..37270 [in whole cluster]
33188..37270 [in contig]
TypeCDS
Length4,083 bp (1,360 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)MtaF
Gene
Gene (GenBank)mtaF
EC number
Keyword
Note
Note (GenBank)
  • PKS; polyketide synthase domains: KS, AT, O-Methyltransferase, ACP
Reference
ACC
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)

close this sectionPKS/NRPS Module

7 malonyl-CoA
KS35..412
AT565..881
OM947..1220
ACP1270..1339

close this sectionSequence

selected fasta
>polyketide synthase [MtaF]
MEKLVRGLSPEKRVSLAKMLLRSAGEAVPEQKLAEPIAIIGIGCRFPGGVNGPEAFWKLL
REGVDAVKQVPGSRWDIDKYYDADPAAPGKMYTRNGAFLEDADQFDSYFFGIPPRAAANL
DPQHRLLLEVSWEALEHAGIAPQSIAGSKTGIFIGGSTGEYTQLVQAAKGADNIDATFLT
GSLLTFATGRLSHFFDLQGPSLAVDTACSSSLVAVHLACQSLRTGESSMALVGGVNLILA
PQGTITTCKARMLAVDGRCKTFDAEADGYGRGEGCGIIVLKRLSDAQKDGDNILAVIRGT
ATNQDGHSSDLTVPNGLAQQAVIRQALENAGLEPGQVDYVEAHGTGTALGDPIELRAIGA
VFGKKQDREQPLLVGSVKTNFGHLEYASGIAGLIKLALSMSHGEIPPHLHFKRGNPYIPW
NELPVEIPTKLTPWKAKKDKRIGSVSSFGASGTNAHVVLEEAPKEGRQTADRERPAHVLS
LSARSEVALKALAGRYAQYLASSGAVNLADVCHTANAGRAQFKHRLALVAESAAQLSQQL
GLFAEGKPAEVLLGQAPNAGKAEVVFLFTGQGSQHEGMGRELYETQPVYRESLKKSDELL
RPVLNESLLEVLYGGKGHLLEQSGVSQPALFAVEYALAQLWKSWGVKPAAVMGHSLGEYV
AACVAGMCTQEEGLKVVAARGRLMEQLPEAGEMVAVLAAEAKVQEAVAPYAQSVSVAAVN
GPEETVVSGRAAQVEQVVSKLKEQGVDCRKLKTTHAFHSPLMEPMLEEFEKEAGKVKWKR
PEIEVVSNVSGQLAKGEEGQKGEYWKKHIRQPVKYWEGLKGLYEKGYRVFVEVGPKPTLV
NVGKRNLPGGEAEWVGSLKQGSNEWQQMLGSVAKLYVKGVGVDWAGFDQDYPRAKVALPT
YPFQRERYWIDSLIPNSDVLVSFYRAVAQMLDVTTVQEGPSLRFATLREAVPGFSWISLY
KAEPENMAGFQKYYDLAVQANREMSQTIFRGLNFPAFSRVLDIGCGHSADLIDLAMKHSH
LELHGCNISPDQIAVGRQRIRGLGLDERITLHYQDSSRDPFPSTYDLVLGFQVIHHIRNK
ADLFANISRSMRNGGYLVMAETLSNMVTPIEHPESTTLFVPQAEWVELLARNQLRVVQAV
EATQEIANFLYDPQFNENFERVTRDSDDVTKKHLHGIHMLGELLQRRLAAYLLFTVTKDE
SMDVDTLRRINAERLSVRLPYATAFRQVQEGTFVLPTSVEDAGAQGATSAASAFANALSS
AEPSQRGQLLGSYLCEQVAHLLKMPVAKLDPEQPLNSMGMDSLLSLELKHKIHAETGMDV
PLDEVLQGASIANLSMRLAERMGNSGQAAVVAKDWEEGEL
selected fasta
>polyketide synthase [MtaF]
ATGGAGAAGTTGGTTCGTGGTCTTTCCCCTGAGAAGCGCGTGAGCCTGGCCAAGATGCTT
CTGCGCTCCGCGGGCGAGGCGGTCCCGGAGCAGAAGCTGGCGGAGCCCATCGCCATCATC
GGGATTGGCTGCCGCTTTCCGGGAGGGGTGAACGGGCCCGAGGCCTTCTGGAAGCTGCTG
CGGGAGGGCGTGGATGCCGTCAAGCAGGTGCCGGGCAGCCGCTGGGACATCGACAAGTAT
TACGATGCTGATCCCGCGGCCCCTGGGAAGATGTACACCCGGAATGGAGCGTTCCTGGAG
GATGCGGATCAATTCGATTCCTACTTCTTCGGGATTCCTCCCCGCGCCGCGGCCAACCTG
GATCCACAGCACCGCCTGTTGCTCGAGGTGAGCTGGGAAGCGCTGGAGCACGCGGGAATC
GCGCCCCAGAGCATCGCGGGCAGCAAGACCGGCATCTTCATTGGTGGCTCCACCGGCGAG
TACACCCAGCTCGTTCAGGCGGCCAAGGGGGCGGACAACATCGACGCCACCTTTCTTACC
GGCAGCTTGCTCACGTTCGCGACCGGCCGTCTGTCGCACTTCTTCGATCTGCAAGGCCCC
AGCCTCGCGGTCGATACGGCATGTTCCTCGTCCCTCGTCGCGGTCCATCTGGCCTGTCAA
AGCTTGCGGACGGGTGAGTCCTCAATGGCGCTCGTGGGAGGCGTGAACCTGATCCTGGCG
CCCCAGGGGACGATCACGACCTGCAAGGCCCGCATGCTGGCCGTCGACGGCCGCTGCAAG
ACGTTCGACGCCGAGGCGGATGGCTACGGGCGAGGCGAGGGGTGCGGCATCATCGTGCTC
AAGCGCCTCTCCGATGCTCAGAAGGACGGGGACAACATCCTGGCCGTCATTCGCGGCACG
GCGACGAACCAGGACGGCCACAGCAGCGACCTCACGGTCCCCAACGGGCTCGCGCAGCAG
GCGGTGATCCGCCAGGCTTTGGAGAACGCCGGGCTCGAGCCTGGGCAGGTGGACTACGTG
GAAGCCCACGGCACGGGTACCGCGCTCGGCGACCCCATCGAACTGCGGGCCATTGGCGCC
GTCTTCGGCAAGAAGCAGGACCGGGAGCAGCCCCTGCTGGTGGGCTCGGTGAAGACCAAC
TTCGGCCACCTGGAGTACGCCTCGGGCATCGCCGGCTTGATCAAGCTGGCGCTCTCGATG
AGCCATGGCGAGATCCCCCCCCACCTCCATTTCAAGCGGGGCAATCCCTACATCCCCTGG
AATGAGCTGCCCGTAGAGATTCCCACGAAGCTGACCCCGTGGAAGGCGAAGAAGGACAAG
CGCATCGGCAGCGTGAGTTCGTTTGGCGCCAGCGGAACGAACGCACACGTGGTGCTGGAG
GAGGCGCCGAAAGAAGGGCGTCAGACAGCGGATCGCGAGCGCCCGGCACACGTGCTGAGC
CTGTCGGCACGCAGCGAAGTGGCGCTGAAGGCCCTTGCGGGCCGGTATGCGCAGTATCTG
GCGTCGAGCGGAGCGGTGAACCTGGCGGATGTGTGCCACACGGCGAATGCAGGGCGCGCG
CAGTTCAAGCACCGGTTGGCGCTGGTGGCGGAGTCCGCCGCGCAGTTGAGCCAGCAGCTA
GGCCTGTTCGCCGAGGGTAAGCCCGCCGAGGTGCTGTTGGGACAAGCACCGAACGCAGGA
AAGGCGGAGGTGGTGTTCCTGTTCACGGGACAGGGAAGCCAGCACGAGGGGATGGGCCGG
GAGCTGTACGAGACGCAGCCGGTGTACCGGGAGAGCCTGAAGAAGAGCGACGAGTTGCTG
AGGCCAGTGCTGAACGAGTCGCTGCTGGAGGTGCTGTACGGAGGAAAGGGACACCTGCTG
GAGCAGAGCGGGGTGTCGCAGCCAGCGCTGTTCGCGGTGGAGTACGCGCTGGCGCAGTTG
TGGAAGAGCTGGGGAGTGAAGCCAGCGGCGGTGATGGGGCACAGCCTTGGAGAGTACGTT
GCGGCGTGCGTGGCGGGGATGTGCACGCAGGAGGAGGGGCTGAAGGTTGTGGCGGCCAGA
GGGAGGCTGATGGAGCAGTTGCCGGAGGCGGGGGAGATGGTGGCGGTGCTGGCGGCGGAG
GCGAAGGTGCAGGAGGCGGTGGCGCCGTACGCGCAGAGCGTGTCGGTGGCGGCGGTGAAC
GGCCCTGAGGAGACGGTGGTGTCGGGTCGAGCAGCGCAGGTGGAGCAGGTGGTGTCGAAG
CTGAAGGAGCAGGGAGTGGATTGCCGGAAGCTGAAGACGACGCACGCGTTCCACTCGCCG
CTGATGGAGCCGATGCTGGAGGAGTTCGAGAAGGAAGCAGGGAAGGTGAAGTGGAAGAGG
CCCGAAATAGAGGTTGTGTCGAACGTGAGCGGGCAGTTGGCGAAGGGGGAGGAGGGGCAG
AAGGGAGAGTACTGGAAGAAGCACATCCGGCAGCCTGTGAAGTACTGGGAGGGGCTGAAG
GGGCTGTACGAGAAGGGGTACCGTGTGTTCGTGGAGGTGGGGCCGAAGCCGACGTTGGTG
AACGTGGGGAAGAGGAACCTGCCGGGAGGGGAAGCGGAGTGGGTGGGCTCGTTGAAGCAG
GGGAGCAACGAGTGGCAGCAGATGCTGGGGAGCGTGGCAAAGCTGTACGTGAAGGGAGTG
GGAGTGGACTGGGCGGGGTTCGACCAGGACTACCCGAGGGCGAAGGTGGCGTTGCCCACC
TATCCCTTCCAGCGCGAGCGATACTGGATCGACTCGCTCATCCCCAACTCAGATGTCCTG
GTGTCCTTCTACCGGGCCGTCGCGCAGATGCTGGATGTCACCACGGTCCAAGAGGGCCCC
TCGCTGCGTTTCGCCACGCTGCGCGAGGCCGTGCCGGGGTTCTCGTGGATCTCGCTCTAC
AAGGCCGAGCCGGAGAACATGGCGGGCTTCCAGAAGTATTATGATCTCGCCGTGCAGGCC
AACCGGGAGATGTCCCAGACCATCTTCCGGGGACTCAACTTCCCGGCCTTCTCGCGCGTG
CTCGACATCGGGTGTGGCCACTCGGCCGACCTGATTGACCTCGCGATGAAGCACTCACAC
CTCGAACTGCACGGGTGCAACATCTCGCCCGATCAGATCGCGGTGGGACGGCAGCGCATC
CGCGGCCTGGGACTCGATGAGCGCATCACGCTGCACTACCAGGACAGCTCGCGGGATCCC
TTCCCCTCGACCTATGACCTGGTCCTCGGCTTCCAGGTCATCCACCACATCCGGAACAAG
GCGGACCTCTTCGCCAACATCAGCCGCAGCATGCGAAACGGCGGCTACCTGGTCATGGCC
GAGACCCTCTCGAACATGGTCACCCCGATCGAGCACCCCGAGTCGACGACCCTCTTCGTG
CCGCAGGCCGAGTGGGTGGAACTCCTGGCGCGCAACCAGCTCCGGGTGGTTCAGGCCGTC
GAGGCCACGCAGGAGATCGCCAACTTCCTCTACGACCCCCAGTTCAACGAGAACTTCGAG
CGGGTGACGCGGGACTCCGACGACGTGACCAAGAAGCACCTGCACGGCATCCACATGCTG
GGCGAGCTGTTGCAGCGCAGGCTGGCCGCTTACCTCCTGTTCACGGTGACCAAGGACGAG
TCGATGGATGTGGACACGCTCCGGCGCATCAATGCCGAGCGGCTCAGTGTTCGCCTTCCC
TACGCGACGGCGTTCCGTCAGGTCCAGGAGGGCACCTTCGTGCTCCCCACGTCCGTGGAG
GACGCGGGGGCCCAGGGAGCCACTTCCGCGGCGAGTGCCTTCGCCAACGCCCTGAGCAGT
GCGGAGCCCAGCCAGCGCGGCCAGCTCCTCGGCAGCTATCTGTGCGAGCAGGTGGCCCAC
CTCCTCAAGATGCCGGTCGCCAAGCTCGACCCGGAACAGCCCCTGAACAGCATGGGCATG
GACTCGCTGCTGTCGCTCGAGCTGAAGCACAAGATCCACGCCGAGACGGGCATGGACGTG
CCGCTGGATGAGGTGCTCCAGGGGGCCAGCATCGCGAACCTGTCGATGCGGCTCGCGGAG
CGGATGGGAAACAGTGGCCAGGCGGCCGTGGTGGCCAAGGACTGGGAGGAAGGCGAGCTG
TGA
[7] KS35..412
[7] AT565..881
[7] malonyl-CoA755..759
[7] OM947..1220
[7] ACP1270..1339
[7] KS103..1236
[7] AT1693..2643
[7] malonyl-CoA2263..2277
[7] OM2839..3660
[7] ACP3808..4017

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [754-870]  8.9e-82 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR009081 Acyl carrier protein-like (Domain)
 [1273-1342]  4.6e-09 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1263-1359]  1.2e-14 SSF47336
SSF47336   ACP-like
 [1270-1339]  14.709 PS50075
PS50075   ACP_DOMAIN
 [1273-1335]  3.7e-09 PF00550
PF00550   PP-binding
IPR013217 Methyltransferase type 12 (Domain)
 [1001-1097]  6.9e-14 PF08242
PF08242   Methyltransf_12
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-286]  4.7e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [294-412]  3.3e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [565-881]  1e-74 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [563-869]  2.4e-72 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [689-754]  4.9e-15 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [35-297]  7.1e-99 G3DSA:3.40.47.10 [298-465]  2.4e-63 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [27-464]  2.2e-104 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [199-215]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [567-862]  3.6e-110 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020803 Polyketide synthase, methyltransferase domain (Domain)
 [947-1220]  1.8e-176 SM00828
SM00828   Methyltransferase in polyketide synthase (P
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1271-1342]  1.2e-08 SM00823
SM00823   Phosphopantetheine attachment site
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-464]  5.1e-225 SM00825
SM00825   Beta-ketoacyl synthase
SignalP No significant hit
TMHMM No significant hit