close all open/close all
Myxo_00060 Myxo_00060   last last

CDS information : Myxo_00070


close this sectionLocation

Organism
StrainDW4/3-1
Entry nameMyxothiazol
Contig
Start / Stop / Direction37,285 / 42,537 / + [in whole cluster]
37,285 / 42,537 / + [in contig]
Location37285..42537 [in whole cluster]
37285..42537 [in contig]
TypeCDS
Length5,253 bp (1,750 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)MtaG
Gene
Gene (GenBank)mtaG
EC number
Keyword
  • glycine
Note
Note (GenBank)
  • NRPS; peptide synthetase domains: Condensation, adenylation, PCP, TE note: motif with homology to monooxygenases located between adenylation core regions A4 and A5; this motif may be involved in the formation of the terminal amide structure
Reference
ACC
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)
[14583260] Melithiazol biosynthesis: further insights into myxobacterial PKS/NRPS systems and evidence for a new subclass of methyl transferases. (Chem Biol. , 2003)
[16807964] A unique mechanism for methyl ester formation via an amide intermediate found in myxobacteria. (Chembiochem. , 2006)

close this sectionPKS/NRPS Module

8
C55..351
A548..739
Ox760..1069
A1098..1308
PCP1394..1461
TE1483..1729

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [MtaG]
MAELSKQDVTLWVEGERLKYRAPKGALSPETLSLLSTHKAALLPYLRRLAAEGESVHPLS
HGQQALWFVHQLAPDSSAYNTALSIRVVSELDIPALRRACQALIDRHGALRTTVATHQGQ
PIQKVRQRAEVHFEQVDVPGMELDALKQLVVRTYQAPFDLERGPLIRVHLFSRGPKDHVL
LLSIHHIVYDGWSLIVIGDELLRHLYATEKAGVPSGLAPPPVTYVDYVRWQSEMLAGPAG
ERLWDYWSKQLAGSLPVLNLPFARPRPAVQGYSGASVPVSLSAALTRQLKALSEREGSTL
YTTVLAAFMVLMHRYTGEEDILLGSPTLGRTQPQFARVVGNFMNMIPLRGNLSGNPVFRD
FLAQLRQTVVGGLAHQDYPFHLLVERLNPERHSNSSPIFQSVFMLQPAQQGNIYAGDEAN
PAMPGGLVLRPFEIPQQEGQFDLILELTETDSGLSGMLKYSTDLFDATGAQQILGHLETL
LESVVEGPGKRLSDLTLLKPSERHQVLQAWNETAGAFSRITCIHETFEAQAQKAPDAIAL
VSGDNRLTYRELDERGNRLAHRLRALGVGPEVRVGLCVHRGLDMVIGMIGILKAGGAYVP
MDPTYPADRLAFMLSDSQAPVVLTEERLRQRLPDTGAKVVCLDAPEEGFSGALGTPRSGV
HAGNVAYTLYTSGSTGRPKGVMVCHRNAESFFAAMDAPLDSQTPGTWLATTSMSFDISIL
EILFSLTRGFQVVIRGEQGAGLPVSAGHRKAPQFSLFYFASDERESTHGKYQLLLEGARF
ADQHGFTAVWTPERHFHPFGGIFPNPSVVSAALAATTRNIRIRAGSVVLPLHSPIRVAEE
WSIVDNLSNGRVDLSFASGWHPNDFVLAPERFADARSGLAGQIQTFKKLWRGEKVNFRNG
VGTDVAVQALPRPIQPDVAVWLTAAGNPETFRLAGELGTNILTHLLGQNLTELEKKIQIY
RDAWKAAGHGPGEGHVTLMLHTFVGDDAAEVRQKVQGPLRQYLKSSVGLLKTVIGPLAHG
AEFESLSEADIDVLLSRAIERYQDQMGLFGTPESCLPMVAKLRDLGVDEIACLIDFGVDR
ESTLAGLHHLNELRERSTQHGEPEDIPALVARHGVTHFQCTPSMLRMLLLEPGGTEALRP
LKKLLIGGEAFPAALGQQVRPLVAGEVLNMYGPTETTIWSSFHRLRPDEATLPIGRPILN
TQMYLLDRHLQPVPMGVPGELLIGGEGVARGYLDRPELTATRFIPDPFGAEPGARLYRTG
DLARYLPDGRIEFLGRMDQQVKVRGVRIEPGEIESALRLHPEIRQAAVVARADAAGEVSL
AAYVVAGPDAQVAPSELRRFLKDKLPVSMIPDHFIRLDALPLTPNKKLDVRALPAPDAPP
VELSVAYVAPRDALELELVALWEELFDLRPIGVASSFFQLGGHSLLAVRLMSRLRAKFGQ
QLPVSLLFQADTIQKLASVLRQEGLAAARTPLVRIQETGDQPPLFFMHPTGGDVLCYAPL
ARQLGPRQPFYALQAVVDQEAESIEAMAARYLEEVRKVRPKGPYRLGGWSTGGILAQAMA
RQLEEAGEQVELLMLLETWSPTVYQRSEGTTALMAWFATDLLGGAGAAQLEASKLETLDE
AAQLDYLFERASASGALPGVERSEMEQRFRIFAKTARALSRYQSDAYRGKVLFLQAEEAA
TPTAGTLPEPQASWGQSLEQVQMYRMPGNHYTMLQSPHVRAVADRMARALEQLSASAEPP
PGAVRAASAR
selected fasta
>non-ribosomal peptide synthetase [MtaG]
ATGGCAGAGCTGTCCAAGCAGGACGTCACGCTCTGGGTGGAAGGCGAACGGTTGAAGTAC
AGGGCTCCGAAGGGAGCCCTGTCTCCGGAGACCCTGAGCCTGCTCTCCACCCACAAGGCG
GCGCTCCTGCCGTACCTCCGCCGGCTCGCGGCGGAGGGGGAGTCCGTTCATCCGCTCTCT
CATGGGCAACAGGCGCTCTGGTTCGTGCACCAACTGGCGCCGGACAGCTCCGCGTACAAC
ACGGCGCTGTCCATTCGCGTCGTCTCCGAGTTGGACATCCCCGCGCTGCGGCGTGCCTGC
CAGGCGCTCATCGATCGCCATGGCGCGCTGCGCACCACGGTGGCGACCCACCAAGGGCAG
CCGATCCAGAAGGTCCGTCAGCGGGCCGAAGTCCACTTCGAGCAGGTGGACGTCCCGGGG
ATGGAGCTCGATGCACTGAAGCAACTGGTGGTGCGGACCTACCAGGCGCCGTTCGATCTG
GAGCGGGGTCCTCTGATCCGCGTGCACCTGTTCTCGCGCGGTCCCAAGGACCACGTGCTG
CTGCTCTCCATCCACCACATCGTCTATGACGGATGGTCGCTGATTGTCATTGGCGACGAA
CTTCTGCGGCACCTCTATGCCACGGAGAAGGCGGGGGTTCCCTCGGGTCTTGCGCCCCCG
CCGGTGACGTACGTGGACTATGTCCGCTGGCAGTCCGAGATGCTCGCGGGCCCCGCGGGA
GAGCGGTTGTGGGATTACTGGTCCAAGCAACTGGCAGGGTCCCTGCCGGTGCTGAACCTG
CCCTTCGCGCGTCCACGGCCCGCGGTGCAGGGGTACTCGGGCGCCTCGGTTCCTGTCTCG
CTGAGCGCGGCGCTGACCCGGCAGCTGAAGGCGCTCTCCGAGCGCGAGGGCTCCACGCTG
TACACCACGGTCCTCGCGGCGTTCATGGTGCTCATGCACCGCTACACGGGTGAGGAGGAC
ATCCTTCTCGGTTCGCCGACGCTCGGACGGACGCAGCCTCAGTTCGCGCGGGTCGTGGGC
AATTTCATGAACATGATTCCCTTGCGGGGGAATCTGTCTGGCAACCCGGTGTTTCGTGAC
TTCCTCGCGCAGCTTCGGCAGACGGTGGTCGGCGGACTCGCCCACCAGGATTATCCGTTC
CACCTCCTCGTGGAGCGGCTGAACCCGGAGCGTCACTCCAACAGCTCCCCCATCTTCCAG
TCCGTCTTCATGCTGCAGCCCGCGCAGCAGGGGAACATCTACGCCGGAGATGAGGCCAAC
CCCGCGATGCCGGGGGGGCTCGTGCTGAGGCCCTTCGAGATTCCGCAGCAGGAGGGGCAG
TTCGACCTGATCCTGGAGCTGACGGAGACGGACTCGGGCTTGAGCGGCATGCTCAAGTAC
AGCACGGACCTGTTCGACGCCACGGGGGCCCAGCAGATCCTGGGGCACCTGGAGACCCTG
CTGGAGAGCGTCGTCGAAGGGCCCGGCAAGCGCCTGTCCGACCTGACGCTCTTGAAGCCC
TCCGAGCGGCATCAGGTGCTCCAGGCGTGGAATGAGACGGCGGGAGCGTTCTCTCGGATC
ACGTGCATTCACGAGACGTTCGAGGCGCAGGCCCAGAAGGCTCCGGATGCCATTGCCCTG
GTGTCTGGGGACAATCGGCTGACCTACCGCGAGCTGGATGAACGCGGAAACCGTCTGGCC
CACCGCCTTCGCGCGTTGGGAGTGGGGCCCGAGGTCCGGGTGGGCCTTTGCGTTCACCGG
GGCCTGGACATGGTGATCGGCATGATCGGCATCCTGAAGGCAGGGGGCGCCTATGTGCCG
ATGGACCCCACGTATCCCGCCGATCGGCTCGCCTTCATGCTCTCGGATTCGCAGGCGCCG
GTGGTGCTCACCGAAGAGCGGCTCCGGCAGCGCTTGCCGGACACGGGGGCGAAGGTGGTG
TGTCTGGATGCTCCGGAGGAGGGCTTTTCGGGCGCACTGGGCACCCCGCGAAGTGGGGTT
CACGCCGGAAACGTTGCCTATACCCTCTACACTTCGGGCTCCACGGGACGGCCCAAGGGG
GTCATGGTCTGCCACCGGAACGCGGAGAGCTTCTTCGCGGCGATGGATGCGCCCCTGGAC
AGCCAGACGCCAGGGACGTGGCTTGCGACGACGAGCATGTCGTTCGACATCTCCATTCTG
GAGATCCTGTTCTCCCTGACCCGTGGCTTCCAGGTCGTCATCCGAGGGGAGCAGGGGGCG
GGGTTGCCGGTCAGTGCCGGTCACCGCAAGGCGCCCCAGTTTAGCCTGTTCTACTTCGCC
AGCGACGAGCGGGAGAGCACCCACGGCAAGTATCAGCTCTTGCTGGAGGGGGCGCGGTTC
GCGGACCAGCATGGATTCACCGCCGTCTGGACGCCCGAGCGGCACTTCCACCCCTTTGGC
GGCATCTTTCCGAACCCTTCCGTCGTCAGTGCCGCCCTCGCGGCCACGACCCGGAACATC
CGGATCCGCGCGGGCAGCGTCGTGCTTCCGCTTCACAGCCCCATCCGTGTCGCCGAGGAG
TGGTCCATCGTGGACAACCTCTCGAATGGACGCGTCGATCTGTCCTTCGCCTCGGGATGG
CACCCGAACGACTTCGTGCTGGCCCCTGAGCGCTTTGCCGATGCGCGGAGCGGCCTGGCC
GGTCAGATCCAGACGTTCAAGAAGCTCTGGCGCGGAGAGAAGGTGAACTTCCGCAATGGG
GTGGGCACCGACGTCGCGGTTCAAGCGCTCCCTCGCCCGATTCAGCCGGACGTCGCGGTG
TGGTTAACCGCCGCGGGCAATCCCGAGACCTTCCGTTTGGCGGGAGAGCTTGGGACGAAC
ATCCTCACCCACCTGCTCGGCCAGAACCTCACGGAGCTGGAGAAGAAGATCCAGATCTAC
CGGGACGCTTGGAAGGCCGCGGGCCATGGCCCTGGAGAAGGCCACGTCACCCTCATGCTG
CACACGTTCGTGGGGGACGACGCCGCGGAGGTCCGCCAGAAGGTGCAAGGACCGCTTCGC
CAGTACCTGAAGAGCTCCGTGGGCCTGCTCAAGACCGTCATCGGTCCGCTGGCGCACGGT
GCGGAGTTCGAGTCTCTCAGTGAAGCGGACATCGATGTGCTGCTGTCGAGGGCGATTGAA
CGGTACCAGGATCAGATGGGCCTGTTTGGAACCCCCGAGAGCTGTTTGCCGATGGTCGCC
AAGCTCCGGGACCTCGGGGTGGATGAGATTGCCTGCCTGATCGACTTCGGCGTGGACCGC
GAGTCCACGCTGGCGGGGCTCCATCACCTGAACGAGCTGCGCGAGCGGAGCACCCAGCAC
GGTGAGCCCGAGGACATCCCCGCACTGGTGGCCCGGCACGGTGTGACCCACTTCCAGTGC
ACGCCCTCGATGCTGCGCATGCTGCTTCTGGAACCGGGCGGCACCGAGGCGCTTCGGCCG
CTGAAGAAGCTCCTCATTGGAGGCGAGGCCTTCCCCGCGGCGCTGGGGCAACAGGTCCGT
CCCCTGGTGGCAGGCGAGGTGCTCAACATGTATGGGCCGACCGAGACGACCATCTGGTCG
TCCTTCCATCGGTTGAGGCCTGATGAGGCCACGCTGCCCATCGGCCGGCCCATCCTGAAC
ACCCAGATGTACTTGCTGGATCGCCACCTTCAACCCGTTCCCATGGGGGTTCCCGGAGAG
CTGCTCATCGGAGGTGAGGGGGTGGCCCGGGGCTACCTCGACCGTCCCGAGCTGACGGCC
ACACGGTTCATCCCCGATCCCTTCGGTGCCGAGCCGGGGGCCCGTCTGTACAGGACCGGC
GATCTCGCGCGGTACCTTCCCGATGGACGCATCGAGTTCCTGGGCCGCATGGACCAGCAG
GTCAAGGTCCGTGGGGTTCGCATCGAGCCCGGGGAGATCGAATCCGCGCTGCGCCTGCAC
CCGGAGATCCGGCAGGCGGCGGTGGTGGCCCGGGCGGATGCGGCGGGCGAGGTGAGCCTG
GCTGCTTATGTCGTGGCAGGTCCAGACGCTCAGGTGGCCCCCTCGGAGCTGCGGCGCTTC
TTGAAGGACAAGCTGCCGGTCTCGATGATCCCCGATCACTTCATTCGGCTCGATGCGTTG
CCGCTGACGCCGAACAAGAAGCTGGATGTCCGGGCCTTGCCCGCCCCCGACGCGCCCCCG
GTGGAGCTTTCGGTGGCGTACGTCGCGCCACGGGATGCGTTGGAGTTGGAGCTCGTCGCG
CTCTGGGAAGAGCTGTTCGATCTGCGTCCCATCGGCGTGGCCAGCAGCTTCTTCCAGCTG
GGAGGTCACTCCTTGCTGGCGGTCCGGTTGATGTCCCGGTTGCGAGCGAAGTTCGGCCAG
CAGTTGCCCGTCTCGCTTCTGTTTCAGGCCGACACCATCCAGAAGCTGGCCTCCGTGCTG
CGCCAGGAGGGCCTCGCTGCGGCCCGCACGCCGCTCGTGCGCATCCAAGAGACGGGCGAT
CAACCGCCCCTCTTCTTCATGCATCCGACGGGTGGGGACGTGCTCTGTTATGCCCCCCTG
GCCAGGCAGCTTGGTCCCCGGCAGCCGTTCTATGCGCTGCAAGCGGTGGTGGATCAGGAG
GCCGAGTCCATCGAGGCGATGGCGGCGCGCTACCTGGAAGAGGTGCGAAAGGTCCGTCCC
AAGGGCCCCTATCGTCTGGGAGGTTGGTCCACGGGAGGGATCCTCGCGCAGGCCATGGCC
CGCCAACTGGAAGAGGCGGGGGAGCAGGTCGAGCTGCTCATGCTCCTGGAAACCTGGTCT
CCCACGGTCTATCAGCGGTCGGAGGGGACCACTGCCCTCATGGCGTGGTTCGCCACGGAT
CTGCTCGGAGGGGCCGGGGCGGCGCAGCTCGAGGCGTCCAAGCTCGAGACGCTCGACGAG
GCGGCGCAGCTCGACTACCTGTTCGAGCGTGCGAGTGCCTCGGGGGCGCTGCCCGGGGTG
GAGCGCTCCGAGATGGAGCAGCGGTTCCGGATCTTCGCCAAGACTGCCCGGGCGCTGTCC
CGGTACCAGTCTGACGCCTACCGGGGCAAGGTTCTCTTCTTGCAAGCGGAGGAGGCGGCC
ACCCCCACGGCGGGGACTCTTCCGGAGCCGCAGGCCAGCTGGGGCCAATCCCTGGAGCAG
GTTCAGATGTACCGGATGCCAGGAAACCACTACACCATGCTGCAAAGCCCCCACGTGCGT
GCGGTCGCTGACCGGATGGCCCGTGCCCTGGAGCAGCTCAGCGCGTCCGCTGAGCCACCC
CCGGGGGCGGTCCGAGCCGCATCCGCGCGGTAG
[8] C55..351
[8] A548..739
[8] Ox760..1069
[8] A1098..1308
[8] PCP1394..1461
[8] TE1483..1729
[8] C163..1053
[8] A1642..2217
[8] Ox2278..3207
[8] A3292..3924
[8] PCP4180..4383
[8] TE4447..5187

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [548-738]  1e-46 PF00501 [1098-1308]  2.20000000000002e-66 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [1483-1729]  5.40000000000002e-29 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [55-351]  1.10000000000001e-72 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [1385-1463]  1.9e-24 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1387-1462]  7.00000734129907e-20 SSF47336
SSF47336   ACP_like
 [1397-1458]  2.9e-12 PF00550
PF00550   PP-binding
 [1394-1461]  PS50075
PS50075   ACP_DOMAIN
IPR011251 Luciferase-like domain (Domain)
 [750-1077]  1.79999754022378e-73 SSF51679
SSF51679   Luciferase_like
 [760-1069]  7.59999999999998e-49 PF00296
PF00296   Bac_luciferase
 [748-1099]  3.39999999999996e-83 G3DSA:3.20.20.30
G3DSA:3.20.20.30   Luciferase_like
IPR024011 Natural product biosynthesis luciferase-like monooxygenase domain (Domain)
 [754-1094]  TIGR04020
TIGR04020   Seco_metab_LLM
SignalP No significant hit
TMHMM No significant hit
Myxo_00060 Myxo_00060   last last